KEGG   Thermotoga neapolitana: CTN_0682Help
Entry
CTN_0682          CDS       T00847                                 

Definition
Pyruvate synthase subunit porD
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
tna  Thermotoga neapolitana
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTN_0682
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTN_0682
   00020 Citrate cycle (TCA cycle)
    CTN_0682
   00620 Pyruvate metabolism
    CTN_0682
   00640 Propanoate metabolism
    CTN_0682
   00650 Butanoate metabolism
    CTN_0682
  Energy metabolism
   00680 Methane metabolism
    CTN_0682
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CTN_0682
Enzymes [BR:tna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CTN_0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(685075..685374)
Genome map
AA seq 99 aa AA seqDB search
MSLKSWKEIPIGGVIDKPGTAREYKTGTWRVMRPILHKEKCIDCMFCWLYCPDQAIVQEG
GIMKGFNYDYCKGCGLCANVCPKQAIEMRPETEFLGEEG
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttaaaagctggaaagaaatccccatcggtggtgtcatcgacaaaccgggaacg
gcaagagaatacaaaacgggaacatggcgtgttatgaggcccatacttcacaaagaaaaa
tgtatagattgtatgttctgctggctgtactgtcctgatcaggcaatcgttcaggaaggc
ggaatcatgaagggattcaactacgactactgcaagggttgcggactctgtgcaaacgtc
tgtccaaagcaggctatagagatgagacctgagacggagtttctgggtgaggagggatga

DBGET integrated database retrieval system