KEGG   Thermotoga neapolitana: CTN_0683Help
Entry
CTN_0683          CDS       T00847                                 

Definition
(RefSeq) Pyruvate synthase subunit porC
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tna  Thermotoga neapolitana
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTN_0683
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTN_0683
   00020 Citrate cycle (TCA cycle)
    CTN_0683
   00620 Pyruvate metabolism
    CTN_0683
   00640 Propanoate metabolism
    CTN_0683
   00650 Butanoate metabolism
    CTN_0683
  Energy metabolism
   00680 Methane metabolism
    CTN_0683
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CTN_0683
Enzymes [BR:tna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CTN_0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(685387..685986)
Genome map
AA seq 199 aa AA seqDB search
MCKEVQSMPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKFVQAFPEYGAERTGAPM
RAFNRIGDEYIRVRSAIENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRQKT
GFNGKICVVDATDIALQEIKRGIPNTPMLGALVRVTGVVPLEVIEKRIEKMFGKKFPQEV
VEANKRALRRGYEEVKCSE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtaaggaggtgcaatcgatgcccgttgcaaagaaatactttgagattcgctggcac
ggtagagccgggcagggcgcaaagagcgcttctcagatgctggcagaggcggcactagaa
gcaggaaaattcgttcaggcgtttccagaatacggtgcagaaagaacgggtgctcccatg
agggcgttcaacagaataggcgatgagtacatcagagtaagatccgccatagagaatcca
gatgttgtcgtggtaatcgatgaaacgctactttctcctgccattgtagagggtctttcg
gaagacggaatcctccttgtgaacacggtgaaagacttcgagttcgtccgacagaaaaca
ggcttcaacggaaagatctgcgtggtcgatgctacagacattgcccttcaggaaataaaa
cgtggtataccgaacacacccatgctaggagcactggtcagagtaacaggagttgtgcca
cttgaagtgatagagaaaagaattgaaaagatgttcggaaagaaattccctcaggaagtg
gtggaagcaaacaagagggccctcaggcgtggatacgaagaagtgaaatgctcagagtga

DBGET integrated database retrieval system