KEGG   Thermotoga neapolitana: CTN_0720Help
Entry
CTN_0720          CDS       T00847                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tna  Thermotoga neapolitana
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:tna00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tna00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(716958..718292)
Genome map
AA seq 444 aa AA seqDB search
MAEFFPEIPKVQFEGKESTNPLAFKFYDPEEIIDGKPLKDHLKFSVAFWHTFVNEGRDPF
GDPTADRPWNRYTDPMDKAFARVDALFEFCEKLNIEYFCFHDRDIAPEGKTLRETNKILD
KVVERIKERMKDSNVKLLWGTANLFSHPRYMHGAATTCSADVFAYAAAQVKKALEITKEL
GGEGYVFWGGREGYETLLNTDLGFELENLARFLRMAVDYAKRIGFTGQFLIEPKPKEPTK
HQYDFDVATAYAFLKSHGLDEYFKFNIEANHATLAGHTFQHELRMARILGKLGSIDANQG
DLLLGWDTDQFPTNVYDTTLAMYEVIKAGGFTKGGLNFDAKVRRASYKVEDLFIGHIAGM
DTFALGFKVAYKLVKDGVLDKFIEEKYRSFREGIGRDIVEGKVDFEKLEEYIIDKETIEL
PSGKQEYLESLINSYIVKTILELR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattctttccagaaatcccgaaagtgcagttcgaaggcaaagaaagcacaaat
ccacttgcgttcaagttctacgatccagaagagatcatcgacggcaaacccctcaaggac
catctgaagttctccgttgccttctggcacaccttcgtgaacgagggaagggatcccttc
ggagacccaacggccgatcgtccctggaacaggtacaccgatcccatggacaaggctttt
gcaagggtggacgccctttttgaattctgcgaaaaactcaacatcgagtacttctgcttc
cacgacagagacatcgctcccgagggaaaaacgctgagggagacaaacaaaattttggac
aaagtagtggagagaatcaaagagagaatgaaagacagcaacgtgaagctcctctggggt
actgcaaacctcttttcccacccaaggtacatgcatggtgcagcgacaacctgcagtgct
gatgtttttgcgtacgcggccgcccaggtgaaaaaagcccttgagatcaccaaagaactt
ggaggagaagggtacgtcttctggggtggaagagaaggatacgaaacactcctcaacacg
gaccttggattcgaacttgaaaacctcgcccgcttcctcagaatggctgtggattatgca
aaaaggatcggtttcaccggacagttcctcatcgaaccaaaaccgaaagaacccaccaaa
caccagtacgacttcgacgttgcaaccgcctatgccttcctgaagagccacggtctcgat
gaatacttcaaattcaacatcgaggcaaaccacgccacactcgccggtcacaccttccag
cacgaactgagaatggcaaggatccttggaaaactcggaagcatcgatgcaaaccaggga
gaccttcttcttggatgggacaccgatcagttcccaacaaacgtctacgatacaaccctt
gcaatgtacgaagtgataaaagcgggaggcttcacaaaaggtgggctcaacttcgatgcg
aaggtgaggagggcttcttacaaagtggaggacctcttcatagggcacatagcgggaatg
gacacctttgcactcggtttcaaggtggcatacaaactcgtgaaggatggtgttctggac
aaattcatcgaagaaaagtacagaagtttcagggagggcattggaagggacatcgtcgaa
ggtaaagtggattttgaaaaacttgaagagtatataatagacaaagaaacgatagaactt
ccatctggaaagcaagaatacctggaaagcctcatcaacagttacatagtgaagaccatt
ctggaactgaggtga

DBGET integrated database retrieval system