KEGG   Thermotoga neapolitana: CTN_0761Help
Entry
CTN_0761          CDS       T00847                                 

Definition
Alpha-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tna  Thermotoga neapolitana
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CTN_0761
  Lipid metabolism
   00561 Glycerolipid metabolism
    CTN_0761
   00600 Sphingolipid metabolism
    CTN_0761
Enzymes [BR:tna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CTN_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(752862..754304)
Genome map
AA seq 480 aa AA seqDB search
MPAVKIGIIGAGSAVFSLRLVSDLCKTPGLSGSTVTLMDIDEERLDAVLTIAKKYVEEVG
ADLKFEKTTSVDEAIADADFVINTAMVGGHTYLEKVRRISEKYGYYRGIDAQEFNMVSDY
YTFSNYNQLKYFVDIARKIERLSPKAWYLQAANPVFEGTTLVTRTVPIKAVGFCHGHYGV
MEIVEKLGLEENRVDWQVAGVNHGIWLNRFRYNGEDAYPLLDRWISEKSKDWKPENPFND
QLSPAAIDMYRFYGVMPIGDTVRNSSWRYHRDLETKKKWYGEPWGGADSEIGWKWYQDTL
GKVTEITKKVAKFIKENPSARLSDLGSVLGKDLSEKQFVLEVEKILDPEKKSGEQHIPFI
DALLNDNRSRFVINIPNKGIIQGIDDDVVVEVPAVVDRDGIHPEKIAPPLPERVVKYYLR
PRIMRMEMALEAFLTGDIRIIKEVLYRDPRTKSDEQVEKVIEEILSLPENEEMRKNYLKK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgtgaagatcggtatcatcggagcaggaagtgccgttttctcactgaggctc
gtgagcgacctttgcaaaactcccggtctttccggaagtaccgttaccctcatggacatc
gacgaagaaaggctagatgcggttctgaccatagcaaaaaagtacgttgaagaagtggga
gccgacctgaagtttgaaaagacaacaagcgtagacgaagccatcgctgatgcggatttt
gtgataaacacagcgatggtgggtggccacacctatcttgaaaaggtcagaaggatcagc
gaaaagtacggatactacagaggaatagacgcgcaggagttcaacatggtctccgactac
tacacgttttcaaactacaaccagctcaagtacttcgtggatatcgcaaggaaaatagag
agactctctccaaaggcgtggtatctgcaggcggcaaatcctgtctttgaaggaacaacc
cttgtgacaagaacggttcccataaaggcagtgggattctgccatggacactacggcgtg
atggagatcgtagagaaactggggctggaagaaaacagggtagactggcaggttgccggt
gtgaaccacggaatatggttgaacaggttcagatacaacggcgaggatgcgtacccactt
ctagatagatggatcagtgaaaaatcgaaagactggaaaccagagaaccccttcaacgac
cagctctctcccgctgcgatagacatgtacagattctacggtgtgatgcccatcggtgac
accgtgagaaactcttcgtggaggtaccacagggatcttgagaccaagaagaaatggtac
ggtgaaccctggggaggagcagattctgaaataggctggaaatggtaccaggacacactt
ggaaaggtaacggagatcacaaagaaggtggcaaagttcatcaaagaaaatccgtccgcg
aggctctccgaccttggaagtgttcttggaaaggatctttcggaaaaacagttcgtcctt
gaagtggaaaagattctcgatcctgaaaaaaagagcggtgaacagcacattcctttcatc
gatgccctgctcaacgacaacagaagtagatttgtgataaacattccaaacaaaggtatc
atacagggtatcgacgacgatgtggttgttgaagttccagcagttgtggacagggacggt
atccatccagaaaagatcgccccaccacttccagaacgtgtggtgaagtattatctgaga
ccgaggatcatgagaatggagatggcactcgaagcgttcctcacgggtgatataaggatc
ataaaagaagttctctacagagacccaaggacaaagagtgacgaacaggtagagaaggtg
atagaagaaatcctttctcttccagaaaacgaagagatgagaaagaattatctgaaaaaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system