KEGG   Thermotoga neapolitana: CTN_0761Help
Entry
CTN_0761          CDS       T00847                                 

Definition
(GenBank) Alpha-glucosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
tna  Thermotoga neapolitana
Pathway
tna00052  Galactose metabolism
tna00561  Glycerolipid metabolism
tna00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CTN_0761
  Lipid metabolism
   00561 Glycerolipid metabolism
    CTN_0761
   00600 Sphingolipid metabolism
    CTN_0761
Enzymes [BR:tna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CTN_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C AlaDh_PNT_C OTCace
Motif
Other DBs
NCBI-ProteinID: ACM22937
UniProt: B9K7K4
Position
complement(752862..754304)
Genome map
AA seq 480 aa AA seqDB search
MPAVKIGIIGAGSAVFSLRLVSDLCKTPGLSGSTVTLMDIDEERLDAVLTIAKKYVEEVG
ADLKFEKTTSVDEAIADADFVINTAMVGGHTYLEKVRRISEKYGYYRGIDAQEFNMVSDY
YTFSNYNQLKYFVDIARKIERLSPKAWYLQAANPVFEGTTLVTRTVPIKAVGFCHGHYGV
MEIVEKLGLEENRVDWQVAGVNHGIWLNRFRYNGEDAYPLLDRWISEKSKDWKPENPFND
QLSPAAIDMYRFYGVMPIGDTVRNSSWRYHRDLETKKKWYGEPWGGADSEIGWKWYQDTL
GKVTEITKKVAKFIKENPSARLSDLGSVLGKDLSEKQFVLEVEKILDPEKKSGEQHIPFI
DALLNDNRSRFVINIPNKGIIQGIDDDVVVEVPAVVDRDGIHPEKIAPPLPERVVKYYLR
PRIMRMEMALEAFLTGDIRIIKEVLYRDPRTKSDEQVEKVIEEILSLPENEEMRKNYLKK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgtgaagatcggtatcatcggagcaggaagtgccgttttctcactgaggctc
gtgagcgacctttgcaaaactcccggtctttccggaagtaccgttaccctcatggacatc
gacgaagaaaggctagatgcggttctgaccatagcaaaaaagtacgttgaagaagtggga
gccgacctgaagtttgaaaagacaacaagcgtagacgaagccatcgctgatgcggatttt
gtgataaacacagcgatggtgggtggccacacctatcttgaaaaggtcagaaggatcagc
gaaaagtacggatactacagaggaatagacgcgcaggagttcaacatggtctccgactac
tacacgttttcaaactacaaccagctcaagtacttcgtggatatcgcaaggaaaatagag
agactctctccaaaggcgtggtatctgcaggcggcaaatcctgtctttgaaggaacaacc
cttgtgacaagaacggttcccataaaggcagtgggattctgccatggacactacggcgtg
atggagatcgtagagaaactggggctggaagaaaacagggtagactggcaggttgccggt
gtgaaccacggaatatggttgaacaggttcagatacaacggcgaggatgcgtacccactt
ctagatagatggatcagtgaaaaatcgaaagactggaaaccagagaaccccttcaacgac
cagctctctcccgctgcgatagacatgtacagattctacggtgtgatgcccatcggtgac
accgtgagaaactcttcgtggaggtaccacagggatcttgagaccaagaagaaatggtac
ggtgaaccctggggaggagcagattctgaaataggctggaaatggtaccaggacacactt
ggaaaggtaacggagatcacaaagaaggtggcaaagttcatcaaagaaaatccgtccgcg
aggctctccgaccttggaagtgttcttggaaaggatctttcggaaaaacagttcgtcctt
gaagtggaaaagattctcgatcctgaaaaaaagagcggtgaacagcacattcctttcatc
gatgccctgctcaacgacaacagaagtagatttgtgataaacattccaaacaaaggtatc
atacagggtatcgacgacgatgtggttgttgaagttccagcagttgtggacagggacggt
atccatccagaaaagatcgccccaccacttccagaacgtgtggtgaagtattatctgaga
ccgaggatcatgagaatggagatggcactcgaagcgttcctcacgggtgatataaggatc
ataaaagaagttctctacagagacccaaggacaaagagtgacgaacaggtagagaaggtg
atagaagaaatcctttctcttccagaaaacgaagagatgagaaagaattatctgaaaaaa
taa

DBGET integrated database retrieval system