KEGG   Thermotoga neapolitana: CTN_0816Help
Entry
CTN_0816          CDS       T00847                                 

Definition
(GenBank) Protein pyrBI
  KO
K00608  aspartate carbamoyltransferase [EC:2.1.3.2]
Organism
tna  Thermotoga neapolitana
Pathway
tna00240  Pyrimidine metabolism
tna00250  Alanine, aspartate and glutamate metabolism
tna01100  Metabolic pathways
Module
tna_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CTN_0816
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CTN_0816
Enzymes [BR:tna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CTN_0816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N PyrI PyrI_C OTCace
Motif
Other DBs
NCBI-ProteinID: ACM22992
UniProt: B9K7Q9
Position
complement(818272..819864)
Genome map
AA seq 530 aa AA seqDB search
MLILKRDFLGRTLAVIEDLSVEEQMFLYEKTRELKKRWYSGEDVSDFRIRKRNVGIYIVF
VEPSTRTKESFINAAKFHAGPNVKVNIFDSEHSSFNKQESYTDTFAMLTGYSDYSIFVVR
TRLEGVCRLLERRISEFALRNGIEIPSFINAGDGKHEHPTQELLDEYTFLEQNNFDNSYI
HLALVGDLLHGRTVHSKVNGLKIFKNVKVDLVAPEELMMPEHYIERMKKNGFEVRTFSSI
EEYLNQKDVAKMWYFTRLQLERMGEDILEKVHLLREAVTFRKEFLEKLPEGVKFYHPLPR
HKLYPTIPNFLDSLPLNGWETQARNGYWVRIVLLSMFGGAIEAPFDTSKKAPEKEEDFII
PAPIVHGTKGVQKDGKRGIKPIENGTVIDHIAKGKTPEEIYATIVKIRKILKLYDVDSAD
GIFRSSDGSFKGYISLPDRYLSKKEIKKLAAISPNTTVNIIKNSSVVEKYRIKLPPTIYG
FEELRCKNENCITNPAHGENVSPSFVRDENGRFVCEYCETPHSFEEIWSI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtgttgattttgaagagagactttcttggaagaacactcgccgtcatagaggacctgagc
gttgaagagcagatgtttctctacgagaaaaccagggaactgaaaaagcgatggtacagc
ggagaggatgtgtcagatttcaggataagaaagagaaacgttggtatatacatcgttttc
gtcgagccaagtaccagaacaaaggagtctttcataaacgccgctaagtttcatgccggg
ccgaacgtgaaggtgaacatcttcgattctgaacactcctccttcaacaaacaggaaagt
tacaccgataccttcgccatgctcacaggatacagtgattattccatattcgtggtgagg
acaagactcgagggagtctgcagactccttgaaagaaggatctccgagtttgctctcaga
aacggcatagagataccgtccttcataaacgcaggagatggaaaacacgagcatcctaca
caggaacttctggacgagtacacgtttttagaacagaacaacttcgacaactcttacata
cacctggcactcgttggggatctgctccatggaagaacagtccactcgaaggtgaacggt
ttgaagatcttcaaaaacgtgaaggtggatcttgtggctcctgaagaactcatgatgccg
gagcactacatcgagagaatgaaaaagaacggctttgaagtcagaaccttttcctcgatc
gaagagtatttgaaccagaaagatgtggcaaagatgtggtatttcacacggcttcaactc
gaacgaatgggtgaagacatccttgaaaaggttcatcttttgcgggaggctgtcacgttc
agaaaagaatttcttgagaaactaccagaaggtgtgaagttctaccatccccttccacga
cacaaactgtatccgaccataccgaactttctcgactctcttcctttgaacggctgggaa
acgcaggcaagaaacggatactgggtgaggatagtgcttctttccatgttcggtggggct
attgaggctcccttcgatacgtcgaaaaaagcaccggagaaggaggaagatttcatcata
ccggctcccatcgtgcacggtacaaagggtgttcaaaaagacggaaagaggggaataaaa
ccaatagaaaatggaaccgtgatagatcacatcgccaaaggaaaaacacctgaggagatc
tacgccacgatcgtcaaaataaggaagattttgaaactctacgatgtggacagtgcggat
ggtatcttcaggtcgagtgatggtagtttcaaaggatacatcagtctgcccgaccgatat
ctttccaaaaaggagataaagaaactcgcagcgatctctccgaacacgactgtgaacatc
ataaagaacagttccgttgtggaaaagtacagaataaaactgccacccaccatatacggt
tttgaagaactgcggtgcaaaaacgaaaactgcatcacaaatcctgcacacggtgagaac
gtgtctccctcatttgtgagagatgaaaacggccgatttgtctgtgagtactgtgaaact
ccccactcgttcgaagagatatggagcatttga

DBGET integrated database retrieval system