KEGG   Thermotoga neapolitana: CTN_0876Help
Entry
CTN_0876          CDS       T00847                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tna  Thermotoga neapolitana
Pathway
tna00230  Purine metabolism
tna01100  Metabolic pathways
Module
tna_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CTN_0876
Enzymes [BR:tna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CTN_0876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA AAA_33 AAA_22 AAA_16 AAA_18 RsgA_GTPase AAA_23 ABC_tran ATPase_2 AAA_5 Rad17 AAA_21 AAA_24 ATP-synt_ab cobW MMR_HSR1 MobB NTPase_1 AAA_29 AAA_30 Zeta_toxin RNA_helicase AAA_19
Motif
Other DBs
NCBI-ProteinID: ACM23052
UniProt: B9K7W9
Position
complement(873262..873885)
Genome map
AA seq 207 aa AA seqDB search
MKGQLFVICGPSGAGKTSIIKEVLKRIDNVVFSVSCTTRPKRPHEVDGEDYFFITEEEFL
RRVEKGEFLEWARVHGHLYGTPRSFVETHIAEGKDVILDIDVQGALSVKKNYPNAVFVYI
APPSYSDLKERILARGTEREADILVRLENAKWELMFMDEFDYIVINDDLQRAIETVLAIL
TAERSKVSRNLDRIEQFKMEVKGWKRW
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtcaactcttcgtcatctgtggaccgtcgggagcgggaaagaccagtatcatc
aaagaagttctcaaaagaatagacaacgtggtattttccgtctcctgcaccaccaggcca
aaacgccctcacgaggtggatggagaggattactttttcatcacagaggaagaattcctg
aggcgtgttgaaaaaggtgagtttctggagtgggcacgtgtgcacggacacctttacggt
acacctcgctctttcgttgaaacgcacatcgccgaaggcaaagatgtgatactggatatc
gacgtgcagggcgcgctgtctgtcaaaaagaactatccgaacgcggtgtttgtatacatc
gctcctccgtcttattctgatcttaaagagaggatccttgcgaggggaacagaaagggaa
gcggacatcctcgtgagactggagaacgcaaaatgggaactcatgttcatggatgagttc
gactacatcgtgatcaacgatgatctccagagggcaatagaaacggtgcttgcgattctg
acggcggaaagatcgaaggtttccagaaacttggataggatagaacagttcaagatggag
gtgaaaggatggaaaagatggtga

DBGET integrated database retrieval system