KEGG   Thermotoga neapolitana: CTN_1024Help
Entry
CTN_1024          CDS       T00847                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tna  Thermotoga neapolitana
Pathway
tna00010  Glycolysis / Gluconeogenesis
tna00052  Galactose metabolism
tna00500  Starch and sucrose metabolism
tna00520  Amino sugar and nucleotide sugar metabolism
tna00521  Streptomycin biosynthesis
tna01100  Metabolic pathways
tna01110  Biosynthesis of secondary metabolites
tna01120  Microbial metabolism in diverse environments
tna01130  Biosynthesis of antibiotics
tna01200  Carbon metabolism
Module
tna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTN_1024
   00052 Galactose metabolism
    CTN_1024
   00500 Starch and sucrose metabolism
    CTN_1024
   00520 Amino sugar and nucleotide sugar metabolism
    CTN_1024
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CTN_1024
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CTN_1024
Enzymes [BR:tna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CTN_1024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ACM23200
UniProt: B9K8B7
Position
999005..999958
Genome map
AA seq 317 aa AA seqDB search
MLELKLIGVDLGGTTFSVGLVTEDGKILKKITRDTLVDNGKDDVIRRIAEAILEVSDGED
APYVGIGSPGSIDRENGVVRFSPNFPDWHNVPLTQEISKLTKKKAFLENDANAFVLGEKW
FGAGKGHDHIVALTLGTGIGGGVITHGQLLTGKDGIGAELGHVVVEPNGPMCNCGTRGCL
EAVASATAIRRFLREGYKKYRDSLVYKLAGSPEKADAKHLFDAARQGDRFALMIRDRVVD
ALARAVAGYIHIFNPEIVIIGGGISRAGSVLFDPLKEKVIDYIMPSFVGTYEIVASPLVE
DAGILGAASIIKERTGG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgctggagttgaaactgataggtgttgatctcggtggaacaacattctctgtgggtctg
gtcaccgaagacggaaagatcctgaagaaaatcacccgcgatacgcttgttgacaacgga
aaagacgatgtgatcagaaggattgcagaggcaattcttgaggtatctgacggtgaggat
gctccttatgttggaataggttctcccggatcgatagacagagaaaacggagttgtaagg
ttctctccgaactttccagactggcacaacgttcccctaacccaggagatatcaaaactc
acaaaaaagaaagctttcctcgaaaacgacgcaaacgctttcgttctcggtgagaaatgg
ttcggtgctggaaaaggccatgaccacatagttgccctgacacttggaacgggaatcgga
ggaggcgtcatcactcacggccagcttcttacaggaaaagacggaataggagcagaactg
ggacacgttgttgtggaaccaaacggtcccatgtgcaactgcggaacacggggatgtctt
gaagcggtagcctctgcaacggcgataagaagattcctcagggaaggctacaagaaatac
cgcgattctctggtttacaaactggcaggctctccagagaaggcagacgccaagcatctt
ttcgacgctgcaaggcagggagatcgttttgccctcatgataagagacagggtggtggac
gcactggcgcgagctgtggctggatacattcatatattcaacccggaaatagtgatcata
ggtgggggtatttccagggcaggaagcgttttgttcgatcctttgaaggagaaggtaata
gattacatcatgccctctttcgtgggaacctatgaaatagtggcaagtcctttggtggag
gacgctgggatcctcggtgcagcctcgataataaaggaaaggacggggggctaa

DBGET integrated database retrieval system