KEGG   Thermotoga neapolitana: CTN_1024Help
Entry
CTN_1024          CDS       T00847                                 

Definition
Glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tna  Thermotoga neapolitana
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTN_1024
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTN_1024
   00052 Galactose metabolism
    CTN_1024
   00500 Starch and sucrose metabolism
    CTN_1024
   00520 Amino sugar and nucleotide sugar metabolism
    CTN_1024
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CTN_1024
   00524 Butirosin and neomycin biosynthesis
    CTN_1024
Enzymes [BR:tna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CTN_1024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
999005..999958
Genome map
AA seq 317 aa AA seqDB search
MLELKLIGVDLGGTTFSVGLVTEDGKILKKITRDTLVDNGKDDVIRRIAEAILEVSDGED
APYVGIGSPGSIDRENGVVRFSPNFPDWHNVPLTQEISKLTKKKAFLENDANAFVLGEKW
FGAGKGHDHIVALTLGTGIGGGVITHGQLLTGKDGIGAELGHVVVEPNGPMCNCGTRGCL
EAVASATAIRRFLREGYKKYRDSLVYKLAGSPEKADAKHLFDAARQGDRFALMIRDRVVD
ALARAVAGYIHIFNPEIVIIGGGISRAGSVLFDPLKEKVIDYIMPSFVGTYEIVASPLVE
DAGILGAASIIKERTGG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgctggagttgaaactgataggtgttgatctcggtggaacaacattctctgtgggtctg
gtcaccgaagacggaaagatcctgaagaaaatcacccgcgatacgcttgttgacaacgga
aaagacgatgtgatcagaaggattgcagaggcaattcttgaggtatctgacggtgaggat
gctccttatgttggaataggttctcccggatcgatagacagagaaaacggagttgtaagg
ttctctccgaactttccagactggcacaacgttcccctaacccaggagatatcaaaactc
acaaaaaagaaagctttcctcgaaaacgacgcaaacgctttcgttctcggtgagaaatgg
ttcggtgctggaaaaggccatgaccacatagttgccctgacacttggaacgggaatcgga
ggaggcgtcatcactcacggccagcttcttacaggaaaagacggaataggagcagaactg
ggacacgttgttgtggaaccaaacggtcccatgtgcaactgcggaacacggggatgtctt
gaagcggtagcctctgcaacggcgataagaagattcctcagggaaggctacaagaaatac
cgcgattctctggtttacaaactggcaggctctccagagaaggcagacgccaagcatctt
ttcgacgctgcaaggcagggagatcgttttgccctcatgataagagacagggtggtggac
gcactggcgcgagctgtggctggatacattcatatattcaacccggaaatagtgatcata
ggtgggggtatttccagggcaggaagcgttttgttcgatcctttgaaggagaaggtaata
gattacatcatgccctctttcgtgggaacctatgaaatagtggcaagtcctttggtggag
gacgctgggatcctcggtgcagcctcgataataaaggaaaggacggggggctaa

DBGET integrated database retrieval system