KEGG   Thermotoga neapolitana: CTN_1064Help
Entry
CTN_1064          CDS       T00847                                 

Definition
Glycerol kinase 2
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tna  Thermotoga neapolitana
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tna00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1033607..1035097)
Genome map
AA seq 496 aa AA seqDB search
MKYVLSLDQGTTSSRAIVFDEKGNVISKVNKEFKQIYPRPGWVEHDPMEIWESQIEVAKR
AIEEAGIKPEEIAAIGITNQRETTIVWDKNTGKPVYNAIVWQCRRTAPICDELKEKGYAE
FIRERTGLVIDAYFSGTKIKWILDNVEGVREKAEKGEVLFGTVDTWLIWNLTGGKVHVTD
YLNASRTMIFNIHKLDWDDEILELLNIPRAMLPQVMPSSHVYGHTTKELLGAEIPIAGDA
GDQQAALFGQACFQPGMLKNTYGTGCFLLMNTGEKAYESKSGLLTTIAWGLNGKVYYALE
GSVFITGAAVQWLRDGLKIISSAAETEELATKVPDNGGVYFVPAFVGLGAPYWDMYARGL
IIGLTRGTTREHIVRAVLESIAYQTRDVVEVMEKESNMKVDTLRVDGGAVVNNFLMQFQA
DILGVPVERPVVNETTALGAAYLAGLAVGYWKDQEEISKLWQLDRRFEPSMDPEERERLY
SKWKEAVSRSLGWEKQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatacgttctttctctcgatcagggtacaacgagttccagggcgatcgtcttcgac
gagaagggaaacgtgatctccaaggtcaacaaagagttcaaacagatctatccaaggccc
gggtgggtggaacacgatccgatggagatctgggagtctcagatcgaagttgcaaaaagg
gcgatcgaagaggcaggaatcaaacccgaagagatagctgctatagggatcacaaaccag
agggaaacaaccatcgtctgggacaaaaacacgggaaaacccgtctacaacgccatcgtg
tggcaatgcagaagaacggctcccatatgcgatgagttgaaagaaaagggctacgctgag
ttcatccgcgaaagaacggggcttgtcatcgacgcgtatttctccggaacaaagatcaag
tggattctcgacaacgttgaaggagtgagggagaaggcagaaaagggagaggtgctcttt
ggaacggtcgacacctggctcatctggaacctcacgggcgggaaagtacacgtcaccgat
tatttgaacgcttccaggacgatgatcttcaacatccacaaactcgactgggacgatgaa
attctggaacttttgaacataccgagggcaatgcttccacaggtgatgccatcgagtcac
gtgtatggtcatacgacaaaagaactgcttggagcagagataccgattgccggggatgcc
ggagatcagcaggctgctctgttcggtcaggcttgcttccagcctggcatgctcaaaaac
acctacggaaccggttgtttcttgcttatgaacaccggagaaaaggcctatgaatccaaa
tcagggcttcttacaacaattgcctggggattgaacggtaaagtctactacgcacttgaa
ggcagtgttttcataacgggggcggccgttcagtggttgagggatggattgaagatcatc
tccagtgcggcagaaactgaggaactcgctacaaaggtaccggacaacggaggtgtgtac
tttgttccggcgttcgtggggcttggtgcaccgtattgggacatgtacgcccgcggtttg
atcatcggtcttaccaggggaaccaccagagaacacatagtgagggctgttcttgaatcg
atcgcctatcagacaagagatgttgtagaagtcatggaaaaggaaagtaacatgaaagtg
gacacactccgtgtggacgggggcgctgttgtgaacaatttcctgatgcagttccaggct
gacatactcggggtccctgtggagcgtcccgttgtaaacgaaacgacggcacttggagct
gcctatcttgcaggactcgccgttggatactggaaggatcaggaagagatatcgaaattg
tggcagttggacagaagatttgaaccatccatggatcctgaagagagagagaggttgtat
tcaaaatggaaagaggctgtgtcgaggtctctcggatgggaaaagcagtga

DBGET integrated database retrieval system