KEGG   Thermotoga neapolitana: CTN_1302Help
Entry
CTN_1302          CDS       T00847                                 

Definition
Endo-1,4-beta-xylanase precursor
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
tna  Thermotoga neapolitana
Brite
Enzymes [BR:tna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     CTN_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1261796..1264864
Genome map
AA seq 1022 aa AA seqDB search
MRSLLRLCLFLVLVSALVTGGEIMNFEREEEGVSPFGRAVVTLSQDVSFRGVYSLKVDGR
TSLWDGVEFDLTGKVSPGKEYRVFFYVYQTSNTPQLFSVLSRVVDESGERYEILLDKVVT
PDVWKKMELIFTSPQRAEKFSLIVASPERTNFPFYIDELQLSSPDEVQEPPPVLHCSFES
ETAEGWIPRGNAKLQVTSRVSHTGRNALFISERSASWEGTQFDLKSIVKPGKTYTFEMWV
YQDSGSPVGILMRMTRKFENEITTKHPIWLYGRTVPSGKWVKLFGIFGLPEGIDVDQLVL
YVYTDGSNTDFYVDDVKIYDKPLVSFEEDVPSLKEIFKDQFKIGAGISEKSILTPFDLEF
LKKHFNSVTERNNMKPVNLLAGVENGRLKFDFSLADLFVDTALKNGISVRGHTLVWHNQT
PEWFFKDENGNLLSKEEMTERLREYIHTVVGHFKGKVYAWDVVNEAVDPNQPDGLRRSTW
YQIMGPDYIELAFRFAREADPNAKLFYNDYNTFEPKKRDIIYNLVKSLKEKGLIDGIGMQ
CHISLATDIRQIEEAIKKFSTIPGIEIHITELDISVYRDSTSNYSEAPRTALIEQAHKMA
QLFKIFKKYSNVITNVTFWGLKDDYSWRATRRNDWPLIFDKDYQAKLAYWAIVAPEVLPP
LPKESKISEGEAVVVGMMDDSYMMSKPIEIYDEEGNVKATIRAIWKDSTIYVYGEVQDAT
KKPAEDGVAIFINPNNERTPYLQPDDTYVVLWTNWKSEVNREDVEVKKFVGPGFRRYSFE
MSITIPGVEFKKDSYIGFDVAVIDDGKWYSWSDTTNSQKTNTMNYGTLKLEGVMVATAKY
GTPVIDGEIDDIWNTTEEIETKSVAMGSLEKNATAKVRVLWDEENLYVLAIVKDPVLNKD
NSNPWEQDSVEIFIDENNHKTGYYEDDDAQFRVNYMNEQSFGTGASAARFKTAVKLIEGG
YIVEAAIKWKTIKPSPNTVIGFNVQVNDANEKGQRVGIISWSDPTNNSWRDPSKFGNLKL
LK
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctcttctgagattgtgtcttttccttgttcttgtgagcgctcttgtcactgga
ggtgaaatcatgaactttgaaagggaggaagaaggggtttcaccctttggaagggcagtt
gttacactctcacaggacgtttccttcagaggagtttactccctgaaagtggatggcaga
acttcactctgggatggagtggagtttgacctcactggaaaggtttcaccggggaaagag
tacagggttttcttttatgtgtaccagacgtcgaacacacctcaactcttcagcgttctt
tccagagttgtggatgaaagtggagaaaggtacgagatactcctcgataaagtcgtcaca
ccggatgtctggaagaagatggaactgatcttcacgtcacctcagagagcagaaaaattc
tcgttgatcgttgcctcacctgaaagaacgaactttccgttctacatcgatgaacttcaa
ctctccagtccggatgaagttcaggaacctccgccggttcttcactgctccttcgagagt
gaaacagccgaaggctggataccccggggaaatgcaaaacttcaggtcacttccagggtt
tctcacaccggtagaaacgcccttttcatctctgaaaggtctgccagctgggagggaaca
cagttcgatctgaaaagcatcgtaaaaccaggaaagacctacacctttgagatgtgggtg
tatcaggattctggaagccctgtcggtatcctcatgaggatgacacgaaagttcgagaac
gaaatcacaacgaagcatcctatctggctgtacgggagaacggttccgtcaggaaagtgg
gtgaagctgtttggtatctttggactcccagaaggaatagacgtggatcaacttgttctt
tacgtctacacggatggctcgaacacagacttctacgtcgacgatgtgaagatctacgac
aaaccgcttgtatcgttcgaagaggatgtaccttccctgaaagagatcttcaaggatcaa
ttcaaaatcggtgccgggatctccgaaaaatccatcctcactccctttgaccttgagttt
ctcaaaaagcacttcaacagtgtcacggagaggaacaacatgaaaccggtgaatctgctc
gccggtgttgaaaatggcaggctgaagtttgacttttcactcgctgatctgttcgttgac
acagcgcttaagaacgggatctccgtgaggggccacacactggtatggcacaatcagaca
cccgagtggttcttcaaagacgaaaatggaaaccttctgagcaaagaagagatgacagaa
aggctcagagaatacatacacaccgttgttggacacttcaaggggaaggtctacgcatgg
gacgttgtgaacgaagcggtcgatccgaaccagccggatgggctgagaagatcgacgtgg
tatcagatcatggggcctgactacatagaacttgcgttcaggtttgcaagggaagcagat
cccaatgcgaaactcttctacaacgactacaacaccttcgaacccaaaaagagagacatc
atctacaaccttgtgaagagtctcaaggagaaaggactcatcgatggaataggcatgcag
tgtcacatcagtcttgcaacggacatcaggcagatcgaagaggccatcaaaaagttcagc
actatccccggtatagaaattcacataaccgaactcgatataagcgtctacagagattcc
acttccaactactcagaagcaccaaggacagctctcatcgagcaggcccacaagatggca
caacttttcaagatcttcaagaagtacagcaacgtgatcacgaacgtcacgttctggggt
ctcaaagacgactactcctggagggcaacaagaagaaacgactggccactgatctttgac
aaagattatcaggcaaaactcgcttactgggcgattgtggctcccgaagtacttccaccc
cttccaaaagagagcaagatctccgaaggagaagcagtggtggtgggaatgatggacgat
tcctacatgatgtcgaagccgatagagatctacgatgaagaagggaacgtgaaggcaacg
atcagggcgatatggaaagacagcacgatctacgtatacggagaggttcaggacgcgacg
aagaagccagcggaagatggagtagcgatcttcatcaacccgaacaacgaaagaacacca
tacctgcagccggatgacacctacgttgtgctgtggacgaactggaagagtgaggtcaac
agggaagacgtagaggtgaagaaattcgttgggcctggattcaggaggtacagttttgag
atgtcgatcacgatacctggtgtggagttcaagaaagacagttacatagggttcgatgta
gcggtgatagacgacgggaaatggtacagctggagcgacacgacgaacagccagaagacg
aacacgatgaactacggaacgctgaaacttgagggagtgatggtggcgacggcgaaatac
ggaacaccggtcatcgatggagagatcgacgatatctggaacacgacggaggagatagag
acgaaatcggttgcgatgggatcactggagaagaacgcaacggcgaaggtgagggtgctg
tgggacgaggagaatctgtacgttcttgcgatagtgaaggatccggttttgaacaaagac
aacagcaatccttgggagcaggattcggtggagatcttcatagacgagaacaaccacaag
acaggctactacgaagacgatgatgcgcagtttagggtgaactacatgaacgagcagtcg
tttgggacgggagcgagtgcggcgaggttcaagacggcggtgaagttgatcgaaggaggc
tacatagtagaggcagccatcaagtggaagacgatcaagccgagtccgaacacggtgata
ggcttcaacgtgcaggtgaacgatgcgaacgagaaaggtcagagggttggtatcatctcc
tggagtgatccaacgaacaacagctggagagatccttcaaagttcggaaacctgaaactc
ctgaaatga

DBGET integrated database retrieval system