KEGG   Thermotoga neapolitana: CTN_1379Help
Entry
CTN_1379          CDS       T00847                                 

Definition
Beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
tna  Thermotoga neapolitana
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CTN_1379
Enzymes [BR:tna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CTN_1379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1345966..1347912
Genome map
AA seq 648 aa AA seqDB search
MLGVCYYPEHWGVEKVEEDFRRMKELGIEYVRIGEFAWSRIEPERGKFNWEWLDRTLEAA
ERMGLKIILGTPTATPPKWLVDEHSEILPVDREGRVKNFGSRRHYCFSSPVYREEAKRIV
SIVAGRYGKHPAVVGWQTDNEYGCHDTVRCYCPRCKKAFQKWLERRYEGDIDKLNRAWGT
VFWSQEYRSFEEIELPNLTPAGPNPSHLLDYYRFASDQVVEFNRLQVEIIRELSPGRFVT
HNFMAGFTDFDHYKISKDLDFASWDNYPLGHTLVFLRAKGESKNPFNRVGHPDIISFSHD
LYRGVGRGRFWVMEQQAGPVNWAPYNLWPAEGAVRLWTWQAFAHGAEVVSYFRWRQAPFA
QEQMHSGLLAPDSSPSQGYQEVKQVFEELKGVDLSEPVKSEVALVFDYETAWVFSIQPHG
EGVNYLDLVLRFYSALRGLGLNVDIVSADSPLDGYRMVVVPSLAIVREEALENFKKYSGV
LVIGPRSGSKTETFQIPEEMPPGLLKEIIPVEVKRVESLGTGNVEVLLWDGKKYPVTIWR
EDVDPTIAEVVARFEDGPGAIFRKENVYYLAFWPDREFLLDFFEKLMKEIGYTVRRLPEG
VRIQKRGKYTFAFNFSPHETEVEIPDDARIVLGDRKVEPYSLVVWEEV
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgctcggagtttgttactatccggaacactggggtgttgaaaaggtagaagaagacttc
agaaggatgaaagaactcgggatagagtacgtgagaatcggagagtttgcttggagcaga
atagagccggagcgaggaaaattcaactgggaatggctggacagaacgctggaagcggcc
gagaggatgggtttgaagatcatcctgggaacacccacagccacacctccaaagtggctt
gtggacgagcattcagagatccttcctgtcgacagagaaggaagagtgaagaactttggc
tccagaagacattactgtttctccagccctgtgtatcgggaagaagcaaagagaatcgtc
tccattgttgcaggaaggtacggaaagcatccggctgttgtgggctggcagaccgacaac
gagtacggctgtcacgacacggtgaggtgttactgtccaaggtgtaagaaagccttccag
aaatggcttgagagaagatacgaaggagacatagataaactgaacagggcctggggaacg
gtgttctggagtcaggaatacaggtccttcgaggagatagaacttcccaacctcacacct
gcaggtccaaatccttcgcatcttctcgattactacagattcgcctcagaccaggtggta
gagttcaacaggctccaggtggagatcataagagaactttctccgggaaggttcgtcacg
cacaacttcatggctggcttcacagactttgatcactacaaaatctcaaaagacctggac
tttgccagctgggacaactatccactcggtcacactctagtctttctgagagcgaaggga
gaaagcaagaacccgttcaacagggtgggacaccctgacataatctccttctcacacgat
ctttatcgtggtgtgggtaggggaaggttctgggtgatggaacagcaggcagggcctgtg
aactgggctccctacaatctctggccggcagagggtgcggtgaggctctggacctggcag
gcttttgcacacggagcagaagtggtttcttacttcaggtggaggcaggcaccctttgca
caggagcagatgcactctggccttcttgctccggactcatctccatctcagggatatcag
gaggtaaagcaggtctttgaagaactgaaaggtgttgatctgagcgaaccggtaaagagt
gaagttgccctcgttttcgattacgagacggcgtgggtgttttccatccagccacacggc
gaaggtgttaattaccttgatcttgtcctcaggttctacagtgccctcagagggcttggc
ctcaatgtggatatcgtgtcggctgattctcctctagatggttacagaatggtggttgtt
ccaagccttgcaatcgtgagggaagaggccctggagaacttcaaaaaatacagcggtgtt
cttgtgattggtccaagaagcggtagcaaaacagaaaccttccagattccagaagagatg
cctcccggtcttctgaaggagatcatacctgtggaggtaaaaagggttgaaagtcttgga
acaggaaacgttgaagttcttctgtgggatgggaaaaagtaccctgtgacgatctggaga
gaggatgtggatcccaccatcgcggaagtggtggcaagatttgaagacggtcccggagcg
atctttcgtaaagaaaacgtgtactatcttgccttctggccggacagagaatttcttctg
gatttcttcgaaaaactgatgaaggagatagggtacacggtgagaagacttccagagggt
gtgcgcattcaaaagagaggaaagtacacgtttgctttcaacttttcacctcatgaaaca
gaagtggagataccggatgatgcccggatcgttctgggcgatcgaaaagtagaaccttac
agtctggttgtctgggaagaagtatga

DBGET integrated database retrieval system