KEGG   Thermotoga neapolitana: CTN_1382Help
Entry
CTN_1382          CDS       T00847                                 

Definition
Beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tna  Thermotoga neapolitana
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CTN_1382
  Lipid metabolism
   00600 Sphingolipid metabolism
    CTN_1382
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CTN_1382
Enzymes [BR:tna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CTN_1382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1350120..1352168
Genome map
AA seq 682 aa AA seqDB search
MTLANRPEWEKAHLDRIKRMVERDKNHPSIIFWSLGNEAGDGMNFEKAALWIKERDNTRL
VHYEGTTRRGESYYVDVFSLMYPKIDVLLEYASRKREKPFIMCEYAHAMGNSVGNLKDYW
DVIEKYPYLHGGCIWDWVDQGIRKKDENGKEFWAYGGDFGDEPNDKNFCCNGVVLPDRTP
EPELYEVKKFYQNIKVRQIAKDTYEVENGYLFTDLEMFDGTWRIRKDGEVVREERFKLSA
RPGEKKILKIPLPEMEDSEYFLEICFSLSEDTLWAKKGHVVAWEQFLIKPPSFEKTVVRE
SVDLSEDGRHLFVRSKDTELVFSKFTGLLKRIVYRGRNILTGSIVPNFWRVPTDNDVGNK
MPERLSIWKRASKERKLFKMFFWKKEENSVSVQSVYQVPGNSWVYLTYTIFGNGDILVDL
SLIPAEGVPEIPRIGLQFAVPGDFRFVEWYGRGPHETYWDRKESGLFARYRRTVQDMIHR
YVRPQETGNRSDVRWFALSDGRVNLFVSGMPVVDFSVWPFSMEDLEKADHVNELPERDFV
TVNVDYRQMGLGGDDSWGAQPHLEYRLLPEPYRFSFRMRVSEEILSWRVLPAISETLHAE
MSSEDMIREGDTLKVKLSLLNDSPLSRKDQIILFVDGKEHSAKKVVIPPFKEETLVFKVN
GLKRGEHLVSTSLNTGKTIYVR
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
gtgacccttgcgaacagaccggaatgggagaaggcacatctcgacaggatcaaaaggatg
gtagagcgtgacaagaaccatcccagcatcatcttctggtcgcttggaaacgaggcagga
gacggaatgaactttgaaaaggccgccctctggataaaagaaagggacaacacaagactc
gtccactacgaaggaacaacaagaaggggagaatcgtactacgtggatgttttctctctc
atgtacccgaagatagatgttcttcttgagtacgcctcaagaaagagggaaaagcccttc
atcatgtgtgagtatgcccacgcgatgggaaacagtgtgggaaatctgaaggactactgg
gatgtgatagaaaagtatccgtatcttcacggagggtgcatctgggactgggtggaccag
ggaatcaggaaaaaggatgaaaacggaaaggaattctgggcgtacggcggagatttcggc
gatgaaccaaacgacaagaatttctgctgcaacggagtggtccttcccgacagaacaccc
gagccagagctttacgaggtgaagaaattctatcagaacatcaaagtgcgccagatcgca
aaagacacctacgaagtggagaacgggtatctcttcacagatcttgagatgttcgatgga
acctggaggatcagaaaagacggtgaagtggtgagagaagaaaggttcaaactctcagcc
aggccaggagaaaagaaaattcttaagataccacttccagagatggaagactccgagtat
ttccttgagatctgtttttccctttctgaagataccctctgggcgaagaaaggacacgtt
gtggcgtgggaacagttcctcataaaacctccttcctttgagaagactgttgttcgagaa
agtgtggatctctcagaagatggaagacatctttttgtgaggtcaaaggacacagaactt
gtgttctctaaattcaccggccttctgaagcgcatcgtgtacaggggaagaaatatcctg
acaggatcgatcgttccaaatttctggagggttccaacggacaacgacgtcggaaacaaa
atgccagagaggctatccatctggaagagggcatcaaaagaaagaaaactcttcaagatg
ttcttctggaagaaagaagaaaacagcgtatccgttcagagtgtctatcaggtacccgga
aacagctgggtgtacctcacctacaccatctttggaaacggtgacatcctcgtggatctt
tccctgattcccgcagaaggtgtaccggagattccaaggatcggtcttcagtttgccgtt
cctggagatttcaggttcgttgagtggtacggaaggggtccgcacgagacctactgggac
agaaaagaaagcggactttttgctcgatacagaaggactgttcaagatatgatacacagg
tacgtcaggccacaggagacaggaaacagatcggacgtgagatggttcgctctctccgat
ggaagggtgaaccttttcgtgtcgggcatgccggtggtggatttcagtgtctggccgttc
tccatggaagacctggaaaaggcagatcacgtgaacgaacttccagaaagggactttgtc
accgtgaatgtggactacagacagatgggacttggaggagacgacagctggggggcacag
ccccacctggagtacaggcttctaccagaaccgtatcgcttttctttcagaatgagggta
agtgaggaaattctatcctggagggttcttccagcgatctctgaaacacttcacgctgag
atgtcctcagaggacatgatacgcgaaggagacaccctgaaagtgaaactttctcttctg
aacgattctccactgagcagaaaagaccagatcatactctttgtggacggaaaagaacat
tcggcaaagaaggtggttataccacccttcaaagaggaaacgctggtcttcaaagtgaac
ggactgaagaggggagagcacctcgtatccaccagtctgaacacgggaaaaaccatctat
gtgaggtga

DBGET integrated database retrieval system