KEGG   Thermotoga neapolitana: CTN_1501Help
Entry
CTN_1501          CDS       T00847                                 

Definition
Alpha-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tna  Thermotoga neapolitana
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tna00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tna00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tna00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1466079..1467497
Genome map
AA seq 472 aa AA seqDB search
MKGGIHMPNIVFVGAGSVRYTIKLVGDLAKTKELYGSRLVLMDIDEERLKATFTLVKKYL
KELKAEYEVEETTSLEKALEGAEFVINTALYRAPGHEDGYVHYEIMREVGERHGYYRGID
SQELNMVSDYYTLSNYNHLKMSLDIAKAVEKISPDAWILQTANPVFEITQLVKRLTKAKI
VGFCHGYAHVFHLAKVLGVEPEELDWQVAGVNHAIWLNRFRWKGEDLYPRLDEWIEKNAS
NWEPKGPWDVDFSPAAIDMYRFYGMYPIGDTVRSGTWKYHYDLETKKKWFGKYGGIDNEV
ERPKFYESLRKQRKRLMELAKEVEKDPTIELTKVWPEVFTTGSESVEQHIPFINALVNGK
KARLVLNVENRGTIKGIPDDVVVEVPVIVDKEGIHPEKIEPDLTERVKKFYLLPRILRME
WALEAFISGDRRVLEEILIRDPRTKSYEQVVAVIEDILNLPFNEEMKKHYSG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggaggaatccacatgcccaacatcgtatttgtgggtgcagggagcgtgaggtac
acgataaagttggtaggtgatctggcaaagacaaaagagctatacgggtcaagactggtt
ttgatggacatcgacgaagaaaggctgaaggcaaccttcacactcgtgaagaagtacctg
aaggagttgaaggcagaatatgaggtggaagagacgacaagccttgagaaggcacttgaa
ggggcagagtttgtcatcaacacagcactctacagggcacctggacatgaagacgggtac
gtgcactacgagatcatgagggaagtaggggaaagacacggttactacagggggatagac
agccaggagctgaacatggtatcggactactacaccctgagcaactacaaccatctgaag
atgagcctcgatatagcaaaagctgtggagaagatctcaccggatgcgtggatactgcag
acggcaaatcccgtctttgagatcactcaacttgtgaagaggctgacgaaggcgaagata
gtggggttctgccatggatacgcacacgtgtttcaccttgcgaaggtgcttggggtagaa
ccagaagaactcgactggcaggtagcaggggtaaaccatgcgatatggctgaacaggttc
aggtggaagggagaggacttatatcccaggctggatgagtggatagagaagaacgcgtcg
aactgggagccgaagggaccatgggacgtggacttttcacctgctgcgatagacatgtac
aggttttacggtatgtatccgataggggacacggtgaggagtgggacgtggaagtaccac
tacgatcttgagacgaagaagaagtggttcggaaagtatggaggaatagacaacgaagtg
gaaaggccgaagttctacgagagtttgaggaagcagagaaagaggctgatggaacttgcg
aaagaagtggagaaagatccgacgatagagctcacgaaggtatggcctgaggtgttcaca
acaggaagtgaaagtgtagagcagcacatacctttcatcaacgcccttgtgaacggaaag
aaggcaaggctggttttgaacgtggagaacagagggacgataaaggggataccggacgat
gtggttgtggaggtgccggtgatagtggacaaggaagggatacatccggagaagatagag
cctgatcttacggagagggtcaagaagttctatcttcttccgaggattttgaggatggaa
tgggcacttgaggcgttcatcagtggtgacaggagggttcttgaggagattctcatcaga
gatcccagaacaaaatcctacgaacaggtcgtcgctgtcatcgaagatatcctcaacctg
ccttttaacgaggaaatgaaaaagcattattcaggatga

DBGET integrated database retrieval system