KEGG   Thermotoga neapolitana: CTN_1517Help
Entry
CTN_1517          CDS       T00847                                 

Definition
(GenBank) Endoglucanase
Organism
tna  Thermotoga neapolitana
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1481556..1482551)
Genome map
AA seq 331 aa AA seqDB search
MKDLIKRLTEAFGPSGREEEVKKILLEELEGHIDGYREDGLGNLIVWKGSGEKKVILDAH
IDEIGVAVTNIDEKGFLMIEPVGGLSPYMLLGKRIRFENGVVGVAGMEGETLEERQENVK
KLSFDKLFVDVGAKSREDAEKICPIGSFGVYDSGFAELPGKYVSKAMDDRVGCAVIVEVF
KRIKPSVTLYGVFSVQEEDGIVGASVAGYNIPASEAIVVDVTDSADTPKAMKRHAMRLSG
GPALKVKDRASISNRKILEKLVETAERFNIKYQMEVLTFGGTNAMGYQRTREGIPSVTVS
IPTRYVHSPSEMVCPEDVEGTVELLIRYLGE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatttgatcaagaggttaacggaagcttttggacccagcggtcgggaagaagag
gtgaaaaagattcttctggaagaactcgaagggcacatagatggttacagggaggatgga
cttggaaatctcatcgtctggaagggatctggagagaaaaaggtgatccttgacgcgcac
atcgacgaaataggtgtggcagtcacgaacatagatgaaaaaggttttctgatgatagaa
cccgtgggaggtctttctccctacatgcttcttggaaagaggatccgctttgaaaacggt
gttgttggtgtcgctggcatggaaggtgaaacgctcgaggaaaggcaggaaaacgtgaag
aaactttccttcgacaaactcttcgtggacgttggagcaaagtctcgagaggatgcggag
aagatctgcccgataggtagttttggggtctatgacagtggattcgctgaactgccagga
aagtacgtttccaaggccatggatgacagagtgggatgcgctgtgatcgtggaggttttc
aaaaggatcaagccatccgttaccctctacggtgtcttcagcgttcaagaggaagatggg
atcgttggtgcctccgttgccggttacaacatcccggcaagcgaagccatcgtcgtagac
gtgaccgattctgcagacactccaaaggcgatgaaaagacacgccatgagactctctggt
gggcctgctttgaaggtgaaggacagagcgtccataagcaacagaaagatcctcgaaaaa
ctcgttgaaactgcggaaagattcaacataaaataccagatggaagttctgacctttgga
ggaacgaacgctatgggatatcagagaacaagagaaggcattccttcggtgaccgtatcc
attcccacacggtacgttcattcaccgagtgagatggtctgtccagaagatgtggagggg
acggtggaacttctgatcagatatctgggggagtga

DBGET integrated database retrieval system