KEGG   Thermotoga neapolitana: CTN_1519Help
Entry
CTN_1519          CDS       T00847                                 

Definition
(GenBank) Endoglucanase
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
tna  Thermotoga neapolitana
Pathway
tna00500  Starch and sucrose metabolism
tna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CTN_1519
Enzymes [BR:tna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CTN_1519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ACM23695
UniProt: B9K9R2
Position
complement(1483571..1484587)
Genome map
AA seq 338 aa AA seqDB search
MKGVNELTTKELLMKLSDLDGPSGYEDSVVSYIESLIKPFVDETKITGHGSLVGYKRGEG
KGKLAFFAHVDEIGFVVSKVEGEFARLEPVGGVDPKVVCASRVRVHTREGVAFGVIGMLA
PHLQSPDSREKVPSFDELFLDLSLSDRTVRIGDVAVIDQKSFEAAGKVVGKALDNRASCA
SLIKTLEFLRRYSHPWDVYFVFSVQEETGCLGALTEAYRINPDVAVVMDVTFASEPPSHD
HIELGKGPVLGLGPVVDRSLVQKISLIAQKHNVSLQKEAVGGRSGTETDFVQLVRAGVRT
ALISIPLKYMHTPVEMVDPGDVEELARLLSIIAVELEV
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggagtgaatgagttgacaacgaaagaacttttgatgaaactctcggatctcgat
ggtccctcaggttacgaagacagtgttgtttcctacatcgagtcactcataaaacccttc
gtggatgagacgaaaattacaggacatgggagtctggttggatacaaaaggggagaagga
aagggaaaacttgccttttttgcacacgtcgacgagataggttttgttgtctcgaaggtg
gagggggagttcgcacgtcttgagccagttggtggggtagatccaaaggtcgtctgtgcc
tcgagggtgcgtgttcataccagagaaggcgttgctttcggtgtgatcggaatgcttgca
ccacaccttcagtcaccggactccagagagaaggttccatccttcgatgagcttttcctc
gatctttccctttccgatcgtaccgttcgaatcggcgatgtagcggtgatagaccaaaaa
tccttcgaagccgctggaaaagtggttggaaaggcccttgacaacagggcaagctgtgcc
tctctgataaaaacactggagtttctcagaaggtattcccatccgtgggatgtttacttt
gttttctccgttcaggaagaaacggggtgtcttggagcgcttacggaggcttacagaata
aacccggatgttgccgttgtgatggacgtcacgttcgcttcagaaccgccctctcatgat
cacatagaactgggaaagggacccgtccttgggctgggacctgtcgttgacagatcgctc
gttcaaaagatctctctcatcgctcagaaacacaacgtttcccttcagaaagaggcggtg
ggaggaaggtccgggacggaaacggactttgttcaacttgtgcgagcaggtgtaaggacc
gctctaatctcgattcctctgaaatacatgcacacaccggtggagatggtcgatccagga
gatgtcgaagaactggcaaggctgctctccatcatcgcagtcgaactggaggtgtag

DBGET integrated database retrieval system