KEGG   Thermotoga neapolitana: CTN_1548Help
Entry
CTN_1548          CDS       T00847                                 

Definition
Aldehyde dehydrogenase
Orthology
K00131  
glyceraldehyde-3-phosphate dehydrogenase (NADP+) [EC:1.2.1.9]
Organism
tna  Thermotoga neapolitana
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTN_1548
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTN_1548
   00030 Pentose phosphate pathway
    CTN_1548
Enzymes [BR:tna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.9  glyceraldehyde-3-phosphate dehydrogenase (NADP+)
     CTN_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1508652..1510070
Genome map
AA seq 472 aa AA seqDB search
MKMLVAGRWVDRDEKIEVLNPYDGSLVDTVPVASEEDIEEAISKAVEGAKIMKRMPIWKR
VEILEKTSELLKERYKEIAVLLVKESGKTIREAEAEVLRTAELFRMSAEEAKRIHGETLP
FDSLKGSERKRGYFVREPVGIVAAIVPFNVPLALCAHKVGPAIAAGNAVIIKPPTQDPLT
NLVLGEILLEAGMPSEAVSILTGPGSRVGTPIVRDERIRMVSFTGSVPVGKTIMKNVGLK
KVSMELGSNSPLIVTETGNLEKAVKATVSGGFSLAGQVCISVQRVYVHKKVFNDFVDLLI
EEVKKIKVGDPMSRDTDMGPVIDEPNALRIESWIKEAVDKGAKLAIGGERNYTLISPTVL
LEVPKDTKIMTEELFGPAVAVNSFEVFEEALEEANSTKYGLQVGVFTSKIDEAFEAIEKL
EFGGVLINEGPRYRADFMPYGGYKESGIGREGIKFAIEEMTEIKTVIFDLRE
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgctggttgcgggcagatgggttgatagagatgaaaagatagaggtcttgaat
ccttatgatggaagtttagtcgatacggttccagttgcctcggaagaggatatagaagaa
gcaataagcaaagctgttgaaggtgcaaagatcatgaaaaggatgcctatctggaagcgg
gttgagattcttgagaaaacctcagagcttctcaaggaaagatacaaggaaatcgctgtt
cttctggtcaaggaatctgggaaaaccataagagaagcagaagcagaagtcctcagaact
gctgaactcttcaggatgtctgcggaagaagcaaaaaggattcatggtgaaacgcttcct
tttgattcattgaaaggttctgaaagaaaaaggggctattttgtgagagaaccggttgga
atcgttgccgcaattgttccattcaacgttcctcttgccctctgcgcccataaggttggc
ccagctatagcagcagggaacgctgtgattataaagcccccaacccaggatcctcttacg
aacctggttttaggggaaatcttacttgaagcgggaatgccttcagaagcggtcagtatc
ttgacgggacctggaagcagagtaggaacccctatagtaagagatgaaagaatcaggatg
gtaagtttcacaggcagcgttcctgtgggaaaaaccattatgaaaaatgttggcttgaag
aaagtatccatggaattgggttcaaacagccctctcattgtaactgaaactggtaactta
gaaaaagccgtgaaagcaaccgtttcgggtggtttttcgcttgccggtcaggtctgcatt
tccgttcagagagtctatgttcacaaaaaggttttcaacgattttgttgatctcctcata
gaggaggtaaagaagataaaagtgggagatcctatgtctagggataccgacatgggaccg
gtcatcgatgaaccgaatgctttgagaatagaaagctggataaaagaagccgtcgataag
ggcgcaaaacttgccatcggaggagagcgtaactataccttgatatctcctaccgttctc
cttgaggttccgaaagataccaagatcatgaccgaggaactgtttgggccagccgttgct
gtaaattctttcgaagtttttgaagaagctctcgaagaagccaactcaacaaaatatggc
cttcaggtgggtgtcttcacttcaaagatagatgaagcgtttgaggcaatcgaaaaactc
gaatttggaggagttttgataaatgaaggaccaaggtacagggcagatttcatgccttat
ggtggctataaagaaagcggtataggaagagaaggtatcaaattcgccatagaagagatg
acagagataaagaccgtcatctttgatttgagggagtga

DBGET integrated database retrieval system