KEGG   Thermotoga neapolitana: CTN_1548Help
Entry
CTN_1548          CDS       T00847                                 

Definition
Aldehyde dehydrogenase
Orthology
K00131  
glyceraldehyde-3-phosphate dehydrogenase (NADP+) [EC:1.2.1.9]
Organism
tna  Thermotoga neapolitana
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tna00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tna00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1508652..1510070
Genome map
AA seq 472 aa AA seqDB search
MKMLVAGRWVDRDEKIEVLNPYDGSLVDTVPVASEEDIEEAISKAVEGAKIMKRMPIWKR
VEILEKTSELLKERYKEIAVLLVKESGKTIREAEAEVLRTAELFRMSAEEAKRIHGETLP
FDSLKGSERKRGYFVREPVGIVAAIVPFNVPLALCAHKVGPAIAAGNAVIIKPPTQDPLT
NLVLGEILLEAGMPSEAVSILTGPGSRVGTPIVRDERIRMVSFTGSVPVGKTIMKNVGLK
KVSMELGSNSPLIVTETGNLEKAVKATVSGGFSLAGQVCISVQRVYVHKKVFNDFVDLLI
EEVKKIKVGDPMSRDTDMGPVIDEPNALRIESWIKEAVDKGAKLAIGGERNYTLISPTVL
LEVPKDTKIMTEELFGPAVAVNSFEVFEEALEEANSTKYGLQVGVFTSKIDEAFEAIEKL
EFGGVLINEGPRYRADFMPYGGYKESGIGREGIKFAIEEMTEIKTVIFDLRE
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgctggttgcgggcagatgggttgatagagatgaaaagatagaggtcttgaat
ccttatgatggaagtttagtcgatacggttccagttgcctcggaagaggatatagaagaa
gcaataagcaaagctgttgaaggtgcaaagatcatgaaaaggatgcctatctggaagcgg
gttgagattcttgagaaaacctcagagcttctcaaggaaagatacaaggaaatcgctgtt
cttctggtcaaggaatctgggaaaaccataagagaagcagaagcagaagtcctcagaact
gctgaactcttcaggatgtctgcggaagaagcaaaaaggattcatggtgaaacgcttcct
tttgattcattgaaaggttctgaaagaaaaaggggctattttgtgagagaaccggttgga
atcgttgccgcaattgttccattcaacgttcctcttgccctctgcgcccataaggttggc
ccagctatagcagcagggaacgctgtgattataaagcccccaacccaggatcctcttacg
aacctggttttaggggaaatcttacttgaagcgggaatgccttcagaagcggtcagtatc
ttgacgggacctggaagcagagtaggaacccctatagtaagagatgaaagaatcaggatg
gtaagtttcacaggcagcgttcctgtgggaaaaaccattatgaaaaatgttggcttgaag
aaagtatccatggaattgggttcaaacagccctctcattgtaactgaaactggtaactta
gaaaaagccgtgaaagcaaccgtttcgggtggtttttcgcttgccggtcaggtctgcatt
tccgttcagagagtctatgttcacaaaaaggttttcaacgattttgttgatctcctcata
gaggaggtaaagaagataaaagtgggagatcctatgtctagggataccgacatgggaccg
gtcatcgatgaaccgaatgctttgagaatagaaagctggataaaagaagccgtcgataag
ggcgcaaaacttgccatcggaggagagcgtaactataccttgatatctcctaccgttctc
cttgaggttccgaaagataccaagatcatgaccgaggaactgtttgggccagccgttgct
gtaaattctttcgaagtttttgaagaagctctcgaagaagccaactcaacaaaatatggc
cttcaggtgggtgtcttcacttcaaagatagatgaagcgtttgaggcaatcgaaaaactc
gaatttggaggagttttgataaatgaaggaccaaggtacagggcagatttcatgccttat
ggtggctataaagaaagcggtataggaagagaaggtatcaaattcgccatagaagagatg
acagagataaagaccgtcatctttgatttgagggagtga

DBGET integrated database retrieval system