KEGG   Thermotoga neapolitana: CTN_1557Help
Entry
CTN_1557          CDS       T00847                                 

Definition
Esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tna  Thermotoga neapolitana
Brite
Enzymes [BR:tna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     CTN_1557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1520919..1521680
Genome map
AA seq 253 aa AA seqDB search
MNFPRCRTVRKSLPIFLEGGSEGVLFIHGYTGSPHDFEYMAQEVNRAGFTVSVPRLPGHG
TCGEDFLLSSAKDWLRRAFDAYYDLSAICERVHVVGLSMGGVIALILASQMNPPKLVTLA
AATHVFDKRIVLTPLLKLFSKKMPRENTERYDDPDIEYLRKEYWSYNWPKQAAELYKLMK
LARKSVSKITSDTLVVAARNDNMVPMKAAEFIYNNIRSEKRKLLVFEKSGHVLSNDVEKE
DVTRAVIEWLKGE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaactttcctcgttgcagaaccgtgagaaaatccctacccattttccttgaaggtgga
agtgaaggggttctcttcattcatggatacaccggatctccccacgactttgaatatatg
gcacaagaagtgaacagagcaggctttacggtctccgtgccgagactgccgggacatgga
acgtgcggcgaggatttcttgctgtcttctgcaaaggactggttgagacgggcgttcgat
gcgtattacgatctgagtgcgatctgcgaaagggtacacgtcgtgggcctttcgatgggt
ggtgtgatcgctctgatccttgcttctcagatgaaccctccaaaactggtcacgcttgct
gctgcaacacacgttttcgacaaaagaatagtcctcacacctcttctgaaactcttttca
aagaagatgccaagggaaaacacagaaaggtacgatgatccagatattgaatacttgaga
aaagaatactggtcctacaactggccaaaacaggcagcagagctctacaaactcatgaaa
ctggcaagaaaaagtgtttcaaagatcacatcagacactctcgtcgtcgcagcaagaaac
gacaacatggttcccatgaaggcagccgagttcatatacaacaacatcagatcagaaaag
aggaagcttcttgtttttgaaaaatccggtcacgttctgagcaacgatgtggaaaaggaa
gatgtcaccagagcagttatcgagtggctgaagggggaatga

DBGET integrated database retrieval system