KEGG   Thermotoga neapolitana: CTN_1616Help
Entry
CTN_1616          CDS       T00847                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tna  Thermotoga neapolitana
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CTN_1616
Enzymes [BR:tna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CTN_1616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1585118..1586095
Genome map
AA seq 325 aa AA seqDB search
MTFHFPSCYHSCENDFENDFIKTQGRMFLVISVVGSSNIDIVLKVDHFTKPGETQKAIEM
NVFPGGKGANQAVTVAKIGEKGCRFVTCIGNDDYSDLLIENYEKLGITGYIRVSLPTGRA
FIEVDKTGQNRIIIFPGANAELKKELIDWNTLSESDILLLQNEIPFETTLECAKRFNGIV
IFDPAPAQGINEEIFQYLDYLTPNEKEIEALSKDFFGEFLTVEKAAEKFLELGVKNVIVK
LGDKGVLLVNKNEKKHFPTFKVKAVDTTAAGDVFNGAFAVALSEGKNPEEAVIFGTAAAA
ISVTRLGAQSSIPAREEVEAFLKNL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
ttgacttttcattttccttcgtgttaccattcttgtgaaaacgatttcgaaaacgatttc
atcaagacacaagggaggatgtttctagtgatttccgtcgtggggagttcaaacatagat
atcgttctgaaggttgatcacttcacaaaacctggtgaaacccagaaagcgatagagatg
aacgtttttccgggtggaaaaggggcgaatcaggctgtaacagtcgcaaaaattggagag
aaaggatgccgttttgtaacgtgcattggaaacgatgattactctgatctgctcatagag
aattacgaaaaactcggaataactggatatataagagttagtcttcctacaggaagagcg
ttcatagaagtcgataaaacaggacaaaacaggatcatcatctttcctggagcgaacgcc
gaactgaaaaaagaattgattgattggaatacgctctctgaaagtgatatccttctcctt
caaaacgaaattccttttgaaaccaccttggaatgtgcgaaaagattcaatggaattgtg
atctttgaccccgcacccgcgcagggaataaacgaagaaatctttcagtacctggactat
ctcacaccgaatgaaaaagagatcgaagccctgtcgaaagatttcttcggtgagtttttg
acggttgagaaagccgctgagaagtttctggaactcggcgtcaagaatgtgatagtgaag
ctcggtgacaaaggagtacttcttgtgaacaaaaatgaaaagaaacactttccgaccttc
aaagtaaaggctgtggacacaacagcggcgggggacgtgttcaatggagcttttgccgtt
gctctgtctgagggaaaaaatcccgaagaggcggtaatctttggaacggcagcagcggcc
atatcggtaacaaggttgggagctcaaagttctattccagcgagagaagaagtagaggcg
tttttgaagaatttatga

DBGET integrated database retrieval system