KEGG   Thermotoga neapolitana: CTN_1624Help
Entry
CTN_1624          CDS       T00847                                 

Definition
Glycerol kinase 1
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tna  Thermotoga neapolitana
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CTN_1624
Enzymes [BR:tna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CTN_1624
Exosome [BR:tna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CTN_1624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1592649..1594127
Genome map
AA seq 492 aa AA seqDB search
MYVLAIDQSTSGTKAIIFDEKGGIVHRVTVYHKQYYPKPGWVEHDPEEIFRNTLDACRKV
IEESGIKPLEIEALAITNQRETTILWEKKSGKPVYNAVVWQCQRGASLCEEIKKRGLEGK
IKEKTGLVVDPYFSASKIRWILDNVEGVKNKAKQGEIAFGTVDSWLIWKLTKGEVHATDF
SNASRTLLLNIHELRWDEEVLEIFEIPPEILPELKSSDSVFGYTDLGFLPKKIPIVGVMG
DSSAALFGQGGFYSGDIKVTYGTGSSTMLNIGEKPNVSDSPIVCSVGWVVKETSSYVLEG
NIHSAGDTIVWLKEKLGIISDPSETEKIALSLENNGGVYLVPAFVGLGAPYWRSDVKAAI
LGLQRNHGKEHVVRAALESIAYQVRDIFEEMVRISSKEPTEVRADGGITRNRFLMQFQAD
ILNIPVLVSNIEEVSARGVAFVALLHLGAFSDLEEIRQKITYREKYEPRMGDELREMYYE
GWKTAIRKLLTE
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtacgttctcgcaatagatcagagtacctctggtacgaaagctattatattcgatgag
aaaggaggaattgttcacagggtaacggtgtaccacaaacagtactatccaaaaccaggc
tgggtagaacacgatcctgaggagatctttcgaaacaccttagatgcatgcagaaaagtc
attgaagaatcgggtataaaaccgctcgagatagaagctctagctattacgaaccaaaga
gaaacaaccatcttgtgggagaagaaatcagggaaaccagtctacaacgctgtggtctgg
cagtgtcagagaggggcttctctctgtgaagagataaagaaaaggggattggaagggaag
ataaaagaaaaaacaggactcgtagttgatccttatttctctgccagtaaaatcaggtgg
attctggacaatgtggaaggcgtaaaaaacaaggcaaagcaaggagaaattgcttttgga
acagtggacagctggctgatctggaaattgactaaaggggaagttcatgcaacagacttt
tcaaatgcgagccgcacacttcttctcaacattcatgaactgagatgggatgaagaagta
ctggagatctttgaaattccacctgaaatcctccctgaactgaaaagttcagattctgtc
ttcggttacaccgatttgggatttttaccgaaaaaaattcccatagtcggtgtcatggga
gattcttctgccgctctctttggacagggaggattctattcaggggatataaaggttacc
tacggtacagggagttccaccatgttgaacataggggaaaaaccaaatgtatcagattcg
cccattgtgtgctctgttggatgggtcgtaaaagagacttccagttatgtactcgagggt
aacattcattcagcaggtgacacaattgtttggttaaaggaaaaactcggaatcataagc
gatccctctgaaacagaaaaaatagcactctctcttgaaaacaacggaggggtttatttg
gttcctgccttcgttgggcttggggccccgtactggcgaagtgatgtgaaagcggctatt
ctggggcttcaaaggaatcatggaaaagaacatgttgttcgagcggctttggagtccata
gcctatcaagtgagagatatcttcgaggagatggtcagaatatccagtaaggaacccacc
gaggtcagggcagatggaggaatcacaagaaacagatttcttatgcagtttcaggcggat
attctgaacataccagttttagtaagcaacatagaggaagtatcagcgagaggagtagct
tttgttgctttgcttcatctcggagcgttcagcgatcttgaagagataaggcaaaagata
acttacagggaaaaatacgaaccccggatgggtgatgaattacgggaaatgtactatgaa
gggtggaaaactgctatcagaaaactactcaccgagtga

DBGET integrated database retrieval system