KEGG   Thermotoga neapolitana: CTN_1667Help
Entry
CTN_1667          CDS       T00847                                 

Definition
Flagellar biosynthesis protein FlhA
Orthology
K02400  
flagellar biosynthesis protein FlhA
Organism
tna  Thermotoga neapolitana
Pathway
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:tna00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    CTN_1667
Secretion system [BR:tna02044]
 Type III secretion system
  Flagellar export apparatus protein
   CTN_1667
Bacterial motility proteins [BR:tna02035]
 Flagellar system
  Flagellar assembly proteins
   Type-III secretion
    CTN_1667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1635479..1637515
Genome map
AA seq 678 aa AA seqDB search
MKNVDIVVSLMIVAIVLLMVLPIPDRMLDFFQILNLTLSMIILFSTMYIRSALELSSFPT
LLLVVTLFRLGLNVASTRLILLEGPQFQGRVIRTFGDFVVRGDYVVGLIVFLILVIIQFV
VITRGAERIAEVAARFTLDAMPGKQMSVDADLNSGLITEEEARKRREEIRREADFYGAMD
GASKFVRGDAIASIIIVFINIVGGLLIGVLRHGMSLGEAAQEYVILTVGDGLSAQIPALL
VSTATGIIVSRAASKENLGKDLVSELSRETKVIILTGGVLIFLGLFTPIPFFSALLGGAL
ILLAVYASRAVPQEELAGPSPAERPSGPVLSTPEEVAEVIQSDTVEVEIGYGLIPLADPS
QGGDLLDRITSIRKQLAFELGLVVSPIRVRDSVLLKPNEYSIKIRGSEVARYELIPNRLL
AINPGTAEEKIPGIPTREPAFNLEAYWIEEWRKEEAQQKGYTVVDPPTVFATHLSEVLRR
HADELLGVKEFELLVEGLKEKFPKLVEDLIPDVMKPAEVKKVLQRLLKEGVSIRNLPTIF
ETLLESAEKSKDIDFLVESVRKALKRQIASQVRSDDGKIHAVVLERELEQKLAESIKEVG
EERELLLNPEVSRELMNRISAALSDLMKKGYQPVVVCSSSIRSYLSRYIARSVPGVFVIS
YDEIPDDYTLQIEGVVKL
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaacgtcgatatcgtggtctctctgatgatagtggccatcgtgcttctgatggta
cttccaattccagatagaatgctggatttctttcagattctcaacttaaccctctcgatg
ataatacttttttccacgatgtacataagaagcgcactggaactttcttcattcccgact
ttgcttcttgtggtaacactcttcaggctgggactcaacgtggcttcaacgaggctcatc
cttctggaaggtccacagtttcagggaagggtcataagaacctttggggattttgtggtc
aggggagattacgttgtgggattgatagtgttcttgatactggtcatcatccagtttgtg
gtcatcacaaggggtgccgagaggatagcggaagtagcggcaaggtttaccctcgatgcc
atgccaggaaaacagatgagtgtggacgcggatctgaacagcggcctgatcacagaagag
gaagcaaggaaaaggcgagaggagataagaagagaagcggatttctacggtgctatggat
ggtgccagtaagttcgtgagaggggatgccatagcgagtatcataatcgttttcatcaac
atagttggtgggcttctcatcggtgttttgaggcacggtatgagtcttggggaagcggca
caggaatacgtgatcctcacggtgggagacggactttccgcccagatacccgctttgctg
gtttccactgcaaccggtatcatcgtgtccagggcagcatcgaaggagaatctcggaaaa
gacctggtgtcggaactttctcgcgaaacgaaggtcatcatcctcacaggcggtgttttg
atctttctgggacttttcactcccattccgtttttcagtgctcttctgggaggggctttg
atcctgcttgcggtctatgcctcaagggccgttcctcaggaagaactcgcaggtccatcg
cccgcggaaagaccgagtggtcctgtactgtcaacccctgaagaggtggctgaggtgata
cagagcgacaccgttgaggtggagatcggatacggtctgattcccctcgccgatccatcc
cagggcggtgacctcctcgacaggatcacatccataagaaaacagcttgccttcgaattg
ggtcttgtggtatctcccatccgggtgagagacagtgtccttctgaaaccaaacgagtat
tccataaagataaggggaagtgaggttgctcgttatgagctgattccaaacaggctcctc
gcaataaatcctggaaccgctgaggagaaaatacccggcataccaaccagggaacccgcc
ttcaaccttgaggcgtactggatagaagagtggagaaaagaagaagcccagcagaagggt
tacaccgtggtggatcctcccaccgtcttcgccacacacctttctgaagtgctgagaaga
cacgccgatgaactgctcggagtcaaggagttcgaactccttgttgaaggtctgaaagag
aagttcccgaaactggttgaagatctcataccggacgttatgaaaccagctgaggtgaaa
aaggttttgcagagactcctgaaggaaggtgtttccatccggaaccttccgaccattttc
gaaacacttttggaaagcgcagaaaagagcaaggacatagatttcctggtggaaagtgtg
agaaaggctctgaaaaggcagatcgcttctcaggtgcgctccgatgacggtaaaatacac
gcggtagtcctcgaaagggaactggagcagaaactcgccgaatcgataaaggaagtgggg
gaagaaagagaactccttctgaatccagaagtgtcacgagaactcatgaacaggatatct
gctgccctgagtgatctgatgaaaaaggggtatcagccggttgtagtctgttcttccagc
atcaggtcgtacctttccagatacatagcaaggagtgtcccaggtgtttttgtgatctcc
tacgatgaaataccggacgattacaccctccagattgaaggcgtggtgaaactgtga

DBGET integrated database retrieval system