KEGG   Thermotoga neapolitana: CTN_1769Help
Entry
CTN_1769          CDS       T00847                                 

Definition
Beta-N-acetylglucosaminidase CbsA
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tna  Thermotoga neapolitana
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CTN_1769
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CTN_1769
Enzymes [BR:tna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CTN_1769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1729980..1730912)
Genome map
AA seq 310 aa AA seqDB search
MIDVDLGKLFFCGFDDFNEEAREVIQKYRPAGVLIYPGVLSKEYLFLDFMNFLSRNGRFI
VSSDHEGGQLEVLKYVPSFPGNLAAGKVDPVFTGRYCEMAGRIMNTLGFNMVFAPVLDLL
SEKGSAVVDLRSFGSDPEVVASHGMEACMGYFKGGVIPCIKHFPGHGKTADDSHYLLPTV
NASFEELWREDLLPFRRIFQSRVKTAVMTAHVKYPAVDDLPATLSKKLITEVLREKLNFK
GLVLSDAMEMKAISENFSVEEAVRFFIEAGGNMILLDNFRGSSRLLRISEETHRGRKYRK
GKSGALHKDR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgatgtggatcttggaaagctgtttttctgtggttttgatgacttcaacgaggaa
gcaagggaggtaatacaaaaatacagaccggccggcgttctgatctaccctggagttctt
tcaaaggagtatctgttccttgatttcatgaactttctgtccagaaatggaagattcatc
gtgagttcggatcacgaaggtggacaacttgaagttttgaagtacgttccctcttttcct
gggaatcttgcagctggaaaggttgatccagtctttacaggcagatactgtgagatggcc
gggaggattatgaacacgctgggtttcaacatggtttttgcaccggttctggatctgctt
tcagaaaaaggctctgctgtagtggacttgagaagctttggatcagatccggaagtagta
gcttcccatggaatggaagcatgcatgggatatttcaaaggaggagtgattccctgtatc
aagcattttccagggcacggaaaaaccgcggatgattcgcattatcttcttccgaccgtc
aatgcatctttcgaggagctgtggagagaagatcttttgccattcagaaggattttccag
agtagagtgaaaacggctgtcatgacggcacatgtgaagtatcctgctgtggatgatctt
ccagcgactctttcgaaaaaactgataacagaagtgcttcgagaaaagttgaacttcaag
ggccttgttctcagtgatgcgatggagatgaaggcgatatctgaaaacttctccgtcgaa
gaggcagtgaggtttttcattgaagcaggagggaacatgatactccttgacaacttcagg
ggatcttcccgtttattacgaatctctgaagaaactcatcgaggacggaagtatcgaaag
ggaaaaagtggagcgctccataaagatcgttga

DBGET integrated database retrieval system