KEGG   Thermotoga neapolitana: CTN_1881Help
Entry
CTN_1881          CDS       T00847                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tna  Thermotoga neapolitana
Brite
Enzymes [BR:tna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CTN_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1838020..1838994)
Genome map
AA seq 324 aa AA seqDB search
MITQGDVMRERLFWILKNHGISDRIAKAFLEVPREEFLTRHYPLSYVYEDTVLVSYEDGE
VFSTSSQPSLMAMFMEWVDLDEGMRVLEIGGGTGYNAAVMSRVVGKKGLVVTVEYFEEVC
RIARENMRRLGIENVVVVCGDGYYGVSDFAPYDVIFVTVGVDEVPEHWFCQLKDGGRVIV
PINMKISARQPAFLFVKNGSHLEGGYKLETRFIKAGGNLGNLLERNRRLLRDFPFQKAIR
VPRLQVFVELVDLLTRRLAEMNGIFYYAGPEGTVEFLNGEMRIYGRAPEIESLLSQWEEC
GYRSFEHLMLHIGYNAVSYISCTI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgataacacagggggatgttatgagagaaaggctcttctggattttgaaaaaccacgga
ataagtgatcgtatcgcaaaggcctttctggaggtaccacgggaagaattcctgacaagg
cactatccactctcctatgtctatgaggacacggtgctcgtttcttacgaggacggggaa
gtcttcagcacttccagtcagccttcgctgatggcgatgttcatggagtgggtggatctg
gatgagggaatgagggttctggaaataggaggcggaacggggtacaacgcagccgtgatg
agcagggttgttggaaagaaaggactcgttgtgaccgtggagtatttcgaagaggtttgc
agaattgcccgagaaaacatgagacgccttggaatagaaaacgttgtcgttgtttgtgga
gatggttattatggtgtttcggattttgcaccgtacgatgtgatcttcgtcaccgttgga
gtggacgaggtaccagaacactggttttgtcagctgaaggatggaggaagggtgatagtt
cccatcaacatgaagatttcggcaagacagcccgctttcctgttcgtgaaaaatggcagt
caccttgaaggtggttacaaactggaaacgaggttcataaaagcgggaggaaatcttgga
aatttgctggaaagaaacagaaggcttctgagagattttccctttcagaaagcgatccgg
gttccccgacttcaggtgtttgtggagctggtggatcttctcacaagaaggctcgcagaa
atgaacgggatcttctactacgcaggaccagaaggaacggtcgagtttttaaacggcgaa
atgagaatttatggaagagcgccagaaatcgaaagtctcctttctcagtgggaagagtgt
ggatacagaagttttgaacacctgatgcttcacatcggctacaacgccgtttcgtatata
tcctgtacgatctga

DBGET integrated database retrieval system