KEGG   Thermotoga neapolitana: CTN_1896Help
Entry
CTN_1896          CDS       T00847                                 

Definition
Bifunctional PGK/TIM
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tna  Thermotoga neapolitana
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTN_1896
   01230 Biosynthesis of amino acids
    CTN_1896
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTN_1896
   00051 Fructose and mannose metabolism
    CTN_1896
   00562 Inositol phosphate metabolism
    CTN_1896
Enzymes [BR:tna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CTN_1896
Exosome [BR:tna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CTN_1896
  Exosomal proteins of bladder cancer cells
   CTN_1896
  Exosomal proteins of melanoma cells
   CTN_1896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1848899..1849654)
Genome map
AA seq 251 aa AA seqDB search
MILAGNWKMHKTISEAKKFVSLLLNELHDVKEFETVVCPPFTALSEVGEILSGRNIKLGA
QNVFYEDQGAFTGEVSPVMLKEIGVEYVIVGHSERRRIFKEDDELINRKIRAVLEKGMTP
IFCVGETLEEREKGLTFCVVEKQVREGLYGLSREEAQKVVIAYEPVWAIGTGKVATPQQA
QEVHAFIRRLLSEMYDDETAETIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKESFV
ELARIMKGVIS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgatcctcgctggaaactggaagatgcacaagaccatatctgaggcaaaaaaattcgtg
tcgctccttctgaacgaactgcacgatgtgaaagagttcgaaacagtggtctgtccaccg
ttcaccgcactatccgaagttggagagatcctctcgggtagaaacatcaaactcggtgct
cagaacgtcttctacgaggaccagggggcgttcacaggagaagtgtcaccggtgatgctg
aaagaaatcggcgttgagtacgtgatcgtggggcactccgaaagaaggcgcatcttcaag
gaagacgatgaactgataaacagaaagatcagggctgttctggaaaagggaatgacaccg
atcttctgtgtgggtgaaactctggaggaaagagaaaagggtctcacattctgcgttgtt
gaaaaacaggtaagagaaggactttacggtctcagcagagaggaagcacagaaggtggtc
atagcctacgaacccgtgtgggcgatcggaacaggaaaggtggcaacaccacagcaggct
caggaagtgcatgcgttcataagaaggcttctttctgagatgtacgacgatgaaacggct
gagacgatcaggatactctacggtggtagcataaaaccagacaacttcctcggcctcatc
gttcagaaagacatcgatggtggtctggttggaggagccagtctgaaagaatcctttgtg
gaacttgcaagaataatgaagggagtgatttcctga

DBGET integrated database retrieval system