KEGG   Thermotoga neapolitana: CTN_1896Help
Entry
CTN_1896          CDS       T00847                                 

Definition
Bifunctional PGK/TIM
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tna  Thermotoga neapolitana
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:tna01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tna01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tna00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tna00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tna00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1848899..1849654)
Genome map
AA seq 251 aa AA seqDB search
MILAGNWKMHKTISEAKKFVSLLLNELHDVKEFETVVCPPFTALSEVGEILSGRNIKLGA
QNVFYEDQGAFTGEVSPVMLKEIGVEYVIVGHSERRRIFKEDDELINRKIRAVLEKGMTP
IFCVGETLEEREKGLTFCVVEKQVREGLYGLSREEAQKVVIAYEPVWAIGTGKVATPQQA
QEVHAFIRRLLSEMYDDETAETIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKESFV
ELARIMKGVIS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgatcctcgctggaaactggaagatgcacaagaccatatctgaggcaaaaaaattcgtg
tcgctccttctgaacgaactgcacgatgtgaaagagttcgaaacagtggtctgtccaccg
ttcaccgcactatccgaagttggagagatcctctcgggtagaaacatcaaactcggtgct
cagaacgtcttctacgaggaccagggggcgttcacaggagaagtgtcaccggtgatgctg
aaagaaatcggcgttgagtacgtgatcgtggggcactccgaaagaaggcgcatcttcaag
gaagacgatgaactgataaacagaaagatcagggctgttctggaaaagggaatgacaccg
atcttctgtgtgggtgaaactctggaggaaagagaaaagggtctcacattctgcgttgtt
gaaaaacaggtaagagaaggactttacggtctcagcagagaggaagcacagaaggtggtc
atagcctacgaacccgtgtgggcgatcggaacaggaaaggtggcaacaccacagcaggct
caggaagtgcatgcgttcataagaaggcttctttctgagatgtacgacgatgaaacggct
gagacgatcaggatactctacggtggtagcataaaaccagacaacttcctcggcctcatc
gttcagaaagacatcgatggtggtctggttggaggagccagtctgaaagaatcctttgtg
gaacttgcaagaataatgaagggagtgatttcctga

DBGET integrated database retrieval system