KEGG   Pyrobaculum neutrophilum: Tneu_0024Help
Entry
Tneu_0024         CDS       T00682                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tne  Pyrobaculum neutrophilum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tne00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tne00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
16196..17110
Genome map
AA seq 304 aa AA seqDB search
MWRGRDVISARDFGRRDLEELFETARYMEKYSKSRLEFLRGRVMAVAFFEPSTRTRLSFE
VAMRRLGGDVIGFWGAEGTSVEKGETLVDTVKMLDAYSDVIVVRHRYEGASKLAAEVAES
PVINGGDGAFNHPTQAMLDVYTMWREFGTVDGLNVGLIGDLRHARTVNSLLETLTNFRVR
VYLISPEYLRPRVETIDYVQSRGLKLSFHTNVEEVIHELDVLYVVRIQKERFIDPLEYEK
VKGSYRITVDMLKNARRHLIILHPLPRVDEIDHRVDATPHARYFRQAALGVPLRMALLYL
ILQS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgggagagatgtgatttctgcacgcgatttcggtaggagggatctcgaggag
ctctttgagacggctaggtacatggagaagtactcaaaaagccggctggagttcctaagg
ggcagggtgatggcagtggcgtttttcgaaccctcgacgcgcaccaggcttagcttcgaa
gtcgccatgaggaggctcgggggcgacgtcatcggcttctggggcgccgagggcaccagc
gtagagaagggcgaaacgcttgtggacaccgtcaagatgttggacgcctactccgacgtc
atagtggtcaggcaccggtacgagggggcatctaagctggcggccgaggtggcggagagc
cctgtgataaacggcggcgacggcgccttcaaccaccctacacaagccatgctcgacgtg
tacaccatgtggagggagttcgggaccgtcgatgggctaaacgtcgggctaataggcgat
ctgagacatgcgcgtacggtaaacagcctcttggagacccttaccaacttcagagtaagg
gtctacctcatctcgcctgagtatctccgcccgcgtgtggagaccatcgactacgtccag
tcgagggggctcaagctcagcttccacaccaacgtcgaggaggtcatccacgagctggac
gtgttatacgtcgttaggatccagaaggagcggtttatagatccgctggagtatgaaaag
gtgaaaggcagctacaggatcaccgtcgacatgttaaaaaacgcgaggagacacctcata
atactccaccccctccccagggtcgacgagatagaccaccgagtcgacgcgacgccacac
gccagatacttcagacaagcggcgttgggagtgccgctgaggatggcccttctgtacttg
atcctgcagtcataa

DBGET integrated database retrieval system