KEGG   Pyrobaculum neutrophilum: Tneu_0024Help
Entry
Tneu_0024         CDS       T00682                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tne  Pyrobaculum neutrophilum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tneu_0024 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tneu_0024 (pyrB)
Enzymes [BR:tne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Tneu_0024 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
16196..17110
Genome map
AA seq 304 aa AA seqDB search
MWRGRDVISARDFGRRDLEELFETARYMEKYSKSRLEFLRGRVMAVAFFEPSTRTRLSFE
VAMRRLGGDVIGFWGAEGTSVEKGETLVDTVKMLDAYSDVIVVRHRYEGASKLAAEVAES
PVINGGDGAFNHPTQAMLDVYTMWREFGTVDGLNVGLIGDLRHARTVNSLLETLTNFRVR
VYLISPEYLRPRVETIDYVQSRGLKLSFHTNVEEVIHELDVLYVVRIQKERFIDPLEYEK
VKGSYRITVDMLKNARRHLIILHPLPRVDEIDHRVDATPHARYFRQAALGVPLRMALLYL
ILQS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgggagagatgtgatttctgcacgcgatttcggtaggagggatctcgaggag
ctctttgagacggctaggtacatggagaagtactcaaaaagccggctggagttcctaagg
ggcagggtgatggcagtggcgtttttcgaaccctcgacgcgcaccaggcttagcttcgaa
gtcgccatgaggaggctcgggggcgacgtcatcggcttctggggcgccgagggcaccagc
gtagagaagggcgaaacgcttgtggacaccgtcaagatgttggacgcctactccgacgtc
atagtggtcaggcaccggtacgagggggcatctaagctggcggccgaggtggcggagagc
cctgtgataaacggcggcgacggcgccttcaaccaccctacacaagccatgctcgacgtg
tacaccatgtggagggagttcgggaccgtcgatgggctaaacgtcgggctaataggcgat
ctgagacatgcgcgtacggtaaacagcctcttggagacccttaccaacttcagagtaagg
gtctacctcatctcgcctgagtatctccgcccgcgtgtggagaccatcgactacgtccag
tcgagggggctcaagctcagcttccacaccaacgtcgaggaggtcatccacgagctggac
gtgttatacgtcgttaggatccagaaggagcggtttatagatccgctggagtatgaaaag
gtgaaaggcagctacaggatcaccgtcgacatgttaaaaaacgcgaggagacacctcata
atactccaccccctccccagggtcgacgagatagaccaccgagtcgacgcgacgccacac
gccagatacttcagacaagcggcgttgggagtgccgctgaggatggcccttctgtacttg
atcctgcagtcataa

DBGET integrated database retrieval system