KEGG   Pyrobaculum neutrophilum: Tneu_0070Help
Entry
Tneu_0070         CDS       T00682                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tne  Pyrobaculum neutrophilum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tneu_0070
Enzymes [BR:tne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tneu_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
65443..66360
Genome map
AA seq 305 aa AA seqDB search
MEIASVGNLNFDVYLRVSELPGPDENAEVLDLYTGGGGSAANFAVAAARLGLAPRFIGAV
GEDPLGEISLRELREEGVDVTYVKRIAGVRSGLVVVLVHPDGVKRMLSYRGANLGLAPGD
LTPEKFRGVRHIHLATGRTELILKAKEVAREVGASLSVDGGTALAKKGLDIVRPAVEGVD
VLFMNQAEARLLAGSHDHRTAVEKLARELRVGELVVTLGARGAAAYGGGKLLHVDAFRVD
AVDTTGAGDCFAAAYIAMHLRGRDPYEKLLFANAAAAIKVTRPGARSSPRYAEVEAFLAS
LGYKI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggagatcgcctcggtgggcaacttgaacttcgacgtctacctacgcgtctccgagctg
ccggggccggacgaaaacgcggaggttctcgacttgtacacggggggagggggctcggcg
gctaacttcgccgtggcggcggctaggctggggctggcgcctaggttcataggcgcggtg
ggcgaggaccccctgggggagatatcgttgcgggagctgagggaggagggcgttgacgta
acctacgtcaagaggatagcgggggttaggtcggggctggtggtcgtcctcgtccacccc
gacggggtcaagaggatgctgtcctacagaggcgccaacctggggctggcccccggcgac
ctcacgcccgagaagttccgcggcgttagacacatacacctcgccacggggaggaccgag
ctgatactaaaggctaaggaggtggcgagggaggtgggcgcctccctctcggtggacgga
gggactgcgctggcaaagaaaggccttgacatagttagaccggcggtggagggcgtagac
gtcctcttcatgaaccaagcggaggcgaggctcctcgccgggtcgcacgaccacagaacc
gcggtggagaagctggcgagggagttgcgggtgggggagctggtggtgaccctaggggcg
aggggggccgccgcatacggcggggggaagctgttacacgtcgacgcctttagggtagac
gcggtggacaccacgggggcgggcgactgcttcgccgccgcctacatagctatgcacctc
agggggcgggacccctacgagaagcttctgtttgccaacgccgcggcggcgataaaggtg
actaggcccggcgcgaggtcctcgccccgctacgccgaggtggaggcttttctggcgtcg
ctcggctacaagatttaa

DBGET integrated database retrieval system