KEGG   Pyrobaculum neutrophilum: Tneu_0133Help
Entry
Tneu_0133         CDS       T00682                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tne  Pyrobaculum neutrophilum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tneu_0133
   01230 Biosynthesis of amino acids
    Tneu_0133
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tneu_0133
   00030 Pentose phosphate pathway
    Tneu_0133
   00051 Fructose and mannose metabolism
    Tneu_0133
  Energy metabolism
   00680 Methane metabolism
    Tneu_0133
Enzymes [BR:tne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Tneu_0133
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Tneu_0133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(119579..120778)
Genome map
AA seq 399 aa AA seqDB search
MRVTVSIIKADVGGFPGHAHVHPKMLEYAAAKLKEAQKRGVIIDYFVYNVGDDISLLMTH
TKGEDNKDIHGLAWETFKEVTDQIAKRFKLYGAGQDLLKDAFSGNIRGMGPQVAEMEFEE
RPSEPIIAFAADKTEPGAFNLPLYKMFADPFTTAGLVIDPSMHEGFIFEVLDVVEHKVYL
LKTPEDAYSLLGLIGTTGRYIIRKVFRRADGAPAAANSVERLSLIAGRYVGKDDPVLLVR
AQSGLPAVGEVLEAFAHPHLVHGWMRGSHAGPLMPARFISVDPERRIAIGPKMTRFDGPP
KVGALGFQLHEGYLEGGVDLFDDPAFDYVRQTAAQIADYIRRMGPFQPHRLPPEEMEYTA
LPKILAKVKPYPADQYEKDRKKYIEAVVKGAKVEESQHD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcgggttacggtttccataatcaaggcagacgtcggcgggttccccggccacgcccac
gtccacccaaaaatgctggagtacgccgcggcgaagcttaaggaggcacagaagaggggg
gtgataattgactacttcgtctacaacgtaggcgacgacatctcgctgttgatgacgcat
acgaagggcgaggacaacaaggacatccacggcctcgcctgggagacctttaaagaggtg
accgaccagatcgccaagaggttcaagctgtacggcgctgggcaggacctgctgaaagac
gccttctccggcaacatcagggggatggggccccaggtggccgagatggagttcgaggag
aggcccagcgagcccatcattgccttcgcggccgacaagacggagcccggggccttcaac
ctgccgctctacaagatgttcgcagaccccttcaccacggccggcctcgtcatcgacccc
tcgatgcacgagggcttcatcttcgaagtcctcgacgtggtggagcacaaggtctacctc
ctcaagacccccgaggacgcctactccctgcttggcctaatcggcaccaccggcagatac
ataattaggaaggtgttcaggagggccgacggcgcgccggccgccgccaacagcgtggag
aggctctccctaatcgccgggcggtacgtcggcaaagacgaccccgtgctcctcgtgaga
gcccagtcgggcctccccgccgtcggcgaggtgcttgaggccttcgcccatccacaccta
gtacacgggtggatgcgcggcagccacgccgggcctctgatgccggcccggtttatatcg
gtggatccggagaggaggatcgccattgggccaaagatgaccagattcgacggccctccc
aaggtgggagccctaggcttccagctacacgagggctacctcgaaggcggcgtagacctc
ttcgacgacccggccttcgactacgtgaggcagacggccgcccagatagccgactacata
cgccgcatgggtcccttccagccgcacaggctacctccggaagagatggagtacaccgcc
ctacccaagatactggccaaggtcaagccgtatccggcggaccagtacgaaaaagaccgc
aagaaatacatagaggctgtggtaaaaggcgccaaggtcgaggagtctcaacacgactag

DBGET integrated database retrieval system