KEGG   Pyrobaculum neutrophilum: Tneu_0133Help
Entry
Tneu_0133         CDS       T00682                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tne  Pyrobaculum neutrophilum
Pathway
tne00010  Glycolysis / Gluconeogenesis
tne00030  Pentose phosphate pathway
tne00051  Fructose and mannose metabolism
tne00680  Methane metabolism
tne01100  Metabolic pathways
tne01110  Biosynthesis of secondary metabolites
tne01120  Microbial metabolism in diverse environments
tne01130  Biosynthesis of antibiotics
tne01200  Carbon metabolism
tne01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tneu_0133
   00030 Pentose phosphate pathway
    Tneu_0133
   00051 Fructose and mannose metabolism
    Tneu_0133
  Energy metabolism
   00680 Methane metabolism
    Tneu_0133
Enzymes [BR:tne01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Tneu_0133
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Tneu_0133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ACB39090
JGI: Tneu0133
UniProt: B1YAL1
Structure
PDB: 

Jmol
Position
complement(119579..120778)
Genome map
AA seq 399 aa AA seqDB search
MRVTVSIIKADVGGFPGHAHVHPKMLEYAAAKLKEAQKRGVIIDYFVYNVGDDISLLMTH
TKGEDNKDIHGLAWETFKEVTDQIAKRFKLYGAGQDLLKDAFSGNIRGMGPQVAEMEFEE
RPSEPIIAFAADKTEPGAFNLPLYKMFADPFTTAGLVIDPSMHEGFIFEVLDVVEHKVYL
LKTPEDAYSLLGLIGTTGRYIIRKVFRRADGAPAAANSVERLSLIAGRYVGKDDPVLLVR
AQSGLPAVGEVLEAFAHPHLVHGWMRGSHAGPLMPARFISVDPERRIAIGPKMTRFDGPP
KVGALGFQLHEGYLEGGVDLFDDPAFDYVRQTAAQIADYIRRMGPFQPHRLPPEEMEYTA
LPKILAKVKPYPADQYEKDRKKYIEAVVKGAKVEESQHD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcgggttacggtttccataatcaaggcagacgtcggcgggttccccggccacgcccac
gtccacccaaaaatgctggagtacgccgcggcgaagcttaaggaggcacagaagaggggg
gtgataattgactacttcgtctacaacgtaggcgacgacatctcgctgttgatgacgcat
acgaagggcgaggacaacaaggacatccacggcctcgcctgggagacctttaaagaggtg
accgaccagatcgccaagaggttcaagctgtacggcgctgggcaggacctgctgaaagac
gccttctccggcaacatcagggggatggggccccaggtggccgagatggagttcgaggag
aggcccagcgagcccatcattgccttcgcggccgacaagacggagcccggggccttcaac
ctgccgctctacaagatgttcgcagaccccttcaccacggccggcctcgtcatcgacccc
tcgatgcacgagggcttcatcttcgaagtcctcgacgtggtggagcacaaggtctacctc
ctcaagacccccgaggacgcctactccctgcttggcctaatcggcaccaccggcagatac
ataattaggaaggtgttcaggagggccgacggcgcgccggccgccgccaacagcgtggag
aggctctccctaatcgccgggcggtacgtcggcaaagacgaccccgtgctcctcgtgaga
gcccagtcgggcctccccgccgtcggcgaggtgcttgaggccttcgcccatccacaccta
gtacacgggtggatgcgcggcagccacgccgggcctctgatgccggcccggtttatatcg
gtggatccggagaggaggatcgccattgggccaaagatgaccagattcgacggccctccc
aaggtgggagccctaggcttccagctacacgagggctacctcgaaggcggcgtagacctc
ttcgacgacccggccttcgactacgtgaggcagacggccgcccagatagccgactacata
cgccgcatgggtcccttccagccgcacaggctacctccggaagagatggagtacaccgcc
ctacccaagatactggccaaggtcaagccgtatccggcggaccagtacgaaaaagaccgc
aagaaatacatagaggctgtggtaaaaggcgccaaggtcgaggagtctcaacacgactag

DBGET integrated database retrieval system