KEGG   Pyrobaculum neutrophilum: Tneu_0177Help
Entry
Tneu_0177         CDS       T00682                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
tne  Pyrobaculum neutrophilum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tneu_0177
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tneu_0177
   00020 Citrate cycle (TCA cycle)
    Tneu_0177
   00620 Pyruvate metabolism
    Tneu_0177
   00640 Propanoate metabolism
    Tneu_0177
   00650 Butanoate metabolism
    Tneu_0177
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tneu_0177
   00680 Methane metabolism
    Tneu_0177
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tneu_0177
Enzymes [BR:tne01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tneu_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
156421..156732
Genome map
AA seq 103 aa AA seqDB search
MTLPKATELPIGAVIPEPGSTRRNTTAGWRTLRPVINDERCVRCQLCWLYCPEGTIVEKK
GVFKVGGRTYDVRYEINYDYCKGCGICANECPTKAIEMVPETP
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgacgctccccaaggccacggagctccccatcggggctgtaataccggagccaggctcg
acgaggagaaacacgacagccggctggagaaccctaaggcctgtgataaacgacgagagg
tgcgtcagatgccagctctgctggctctactgcccagagggcaccatcgtggagaaaaaa
ggcgtgtttaaagtaggcggtaggacatacgacgtgaggtacgagataaactacgactac
tgcaagggctgcggcatatgcgcgaacgagtgccccacgaaggcgatagagatggtgccg
gagaccccatga

DBGET integrated database retrieval system