KEGG   Pyrobaculum neutrophilum: Tneu_0287Help
Entry
Tneu_0287         CDS       T00682                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tne  Pyrobaculum neutrophilum
Pathway
tne00860  Porphyrin and chlorophyll metabolism
tne01100  Metabolic pathways
tne01110  Biosynthesis of secondary metabolites
tne01120  Microbial metabolism in diverse environments
Module
tne_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tneu_0287
Enzymes [BR:tne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Tneu_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 NAD_binding_10 Mcl1_mid
Motif
Other DBs
NCBI-ProteinID: ACB39239
JGI: Tneu0287
UniProt: B1YBA8
Position
complement(250731..251441)
Genome map
AA seq 236 aa AA seqDB search
MRLAVTSPRALEAFRALAARAGVEVVEAPMAVLKPAPLDAEAVVRALEEADLVVFASGHA
AYRAAEALGPLRDAASRLLAKAVVATAEGRKGAVMVKNAFGVEPQVVSDTVEGLSLPGCR
RAAVFHYGWRDPELLAKVACPAAEFQPYVAEPPPREAVERVLSADAVVFTSALAVRYFAE
VGGAEAVERLKGLIVVAAGPGVSKALAELGVPHKTAPQGRIGPLAEYAISLLLSRG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcggcttgccgtcacttcgccgagggctttggaggcgtttagggctttggcggctagg
gcgggggtagaggtggtggaggccccaatggctgtgttgaagccggcgcctctagacgcc
gaggcggtggtgcgggcgctggaggaggccgacctggtggtttttgcgtcggggcacgcg
gcgtatagagcggcggaggcgctggggccccttagggatgcggcgtctaggctgttggcc
aaggccgttgtggcgacggcagaggggaggaagggggctgtgatggtgaagaacgccttt
ggggtagagccccaggtcgtttctgacacggtggaggggctctccctcccggggtgtagg
agagccgccgttttccactacggctggagggaccccgagcttctggctaaggtggcctgc
cccgcggccgagtttcagccctacgtggccgagcccccgccgagggaggccgtggagcgt
gtcttgtccgcagacgcggtggtgttcaccagcgccctagccgtgaggtacttcgccgag
gttggcggggcagaggcggtggagaggctcaaggggcttatcgttgtggcggcgggcccc
ggcgtctccaaagccctagcggagctgggggtgccgcacaagaccgccccccagggtagg
ataggcccgctggccgagtacgccatctcgcttctgctgagccggggctag

DBGET integrated database retrieval system