KEGG   Pyrobaculum neutrophilum: Tneu_0375Help
Entry
Tneu_0375         CDS       T00682                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
tne  Pyrobaculum neutrophilum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tneu_0375
Enzymes [BR:tne01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Tneu_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
333069..334982
Genome map
AA seq 637 aa AA seqDB search
MEEARERRVVYPFAAIVGQEKAKLALLAVSVNPAIGGVLLAGDKGTGKSTMVRALADLLP
EIEVVEGCPFGCNPHNPAEMCDECYLKWKRGEIKVAKRKMRVIDLPLSITVDRLVGTLDI
KRALAEGIRALQPGLLAEANRNILYIDEVNLLDDYIIDVLLDAAAMGWNIVEREGISVKH
PARFILIGSMNPEEGELRPQLLDRFGLYVKVEASMNPEERIEIIRRVEEFNRDPIAFYRK
WEPEQNRLREAISRARQIVNDVQIDEDLMKFIVKTITDLKIRSHRAEITVVRTAKSIAAL
DGRLKVNLDDVKKAMELALPHRLRATPFEPPPPPPASSPPSPQQNDGGGDRGPQGGGGGQ
GGGEAGGGRGGGERQFGEEKPPYEPRETPVRLRGEEEGGGGRRARRAYELKIGGSHGVVT
TYAIPRGEAADIHITATLTAAALRRLGAGLPLAVDNEDLRINVRRARVPVLRVVLLDSSG
SMAALRRIAVAKGLVRKLAESSYRGREYISLIVFRGGGAQVVVPPVRKYEEVLAALSAVP
TGGRTPLPHALETLYRIAKSFRAKYRDAKVVGVLITDGKANVPLYRNVTEDLERLSHLLK
KAGVELEIYATRGRGFDPAPTYIDLIASITSAKVVEV
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggcgagggaacgccgggttgtctaccccttcgccgcgattgtaggccaagaa
aaggccaagctggctctgctggcggtctcggtgaaccccgccattggcggggtcctcctc
gccggagacaaggggacgggcaaatcgactatggtgagggcgctcgccgacctcctcccc
gagatagaggtggtagaggggtgccccttcggttgcaacccacacaacccggcggagatg
tgcgacgagtgctacctgaagtggaaaagaggcgagataaaggtggcgaagaggaagatg
cgcgttatagacctccccctaagcatcacagtggataggctggtggggacgctcgacata
aagagggcgctcgccgaggggataagagcgcttcagccgggcctcctcgccgaggccaac
cgaaacatactgtatatagacgaggtaaacctgctagacgactacataatagacgtcttg
ttagacgctgcggcgatgggctggaacatcgtggagagagagggcatatctgtgaaacac
ccagcccgcttcatattaatcggtagtatgaacccagaggagggcgagcttaggccccag
ctgttagacagattcggcctatatgtgaaggtggaggcctccatgaacccggaggagagg
atagagataatcaggagggtcgaggagttcaacagagacccaatagccttctacagaaag
tgggagcccgagcagaacaggcttagggaggctatatctagagctagacagatagtcaac
gacgtccaaatagacgaagacctcatgaagttcatagtcaagactataacagacctaaag
atcagaagccacagggcagagattacggttgttagaacagccaagtccatagccgccctc
gacggccgcctcaaggtcaacctagacgacgtgaaaaaggccatggagctcgccctaccc
caccgcctcagggcaacacccttcgagccgcctccgccgcctcccgcaagctctccgcca
tctccccagcagaacgacggcggaggcgacagagggccgcagggaggcggagggggacag
ggagggggagaggcgggcggcgggaggggaggcggggagaggcagttcggcgaggagaag
cccccctacgagccccgggagacgcccgtccgccttaggggggaggaggaggggggcggc
gggaggcgggctaggagagcctacgagcttaaaatcggcgggagccacggcgtagttaca
acctacgcgatcccaaggggggaggcggcggatatacacatcaccgcgacgttgacagcc
gcagcgctcagaaggctaggcgccggcctccccctcgccgtagataatgaggatcttaga
ataaacgtaagaagagccagagtgcccgtcctccgcgtcgtcctgcttgactcaagtggg
agcatggccgccttgaggaggatagcggtggcgaaggggcttgtgagaaagctagcggag
tcctcctacagggggagggagtacatctcgttgatcgtcttcagaggaggcggagcccag
gtggtggtgcccccagtgaggaaatacgaggaggtcctcgccgccttatccgccgtaccc
accggcggcagaacgccgttgccccacgccctggagaccctctataggatagccaaaagc
ttcagggctaaatatagagacgccaaggtggtgggggtcttgataacagacggcaaagcc
aacgtcccactgtatagaaacgtaacagaggacctagagaggctctcccacctgttaaag
aaggcgggtgtggagctggagatatacgccaccagaggcagaggcttcgacccagccccc
acctacatagacctaatagcgagcatcacctcggccaaggtagtagaggtgtga

DBGET integrated database retrieval system