KEGG   Pyrobaculum neutrophilum: Tneu_0542Help
Entry
Tneu_0542         CDS       T00682                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tne  Pyrobaculum neutrophilum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tne00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
494837..495925
Genome map
AA seq 362 aa AA seqDB search
MEDFVALLKTLSEARGPSGFEDEVREIVIKEMEPYVDEVLVDRWGNVIGVKRGASEVRAM
VAAHMDEIGLVVDHVEKEGFLRFRPIGGWNEVTLLGQRVWVRTQDGRWVRGVVGVTPPHV
TPSGHEREAPEMKDLYIDVGARSREEAEKMGISVGSVAVLERELAVLNGRVATGKAFDDR
VGLAVMLYTLRQLGDLPVTLYAVATVQEEVGLRGAQIAADRIAPHYAVALDTTIAADVPG
VGERLHVTKLGAGPAIKVIDGGRGGLFIAHPGLRDHIVKIAREAGIPHQLEVLYGGTTDA
MAIAFRREGVPAAAISIPTRYVHSPVELVDLSDALNASRLLKQVLEKTTPAAVEKFLERR
VK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtggaggacttcgtcgctctcctaaagaccctatccgaggcgagaggcccctccggcttc
gaggacgaggtgagggagatcgtgataaaggagatggagccgtacgtagacgaggtgttg
gtggacaggtgggggaacgtaataggggtcaagaggggggcctccgaggtccgggccatg
gtggcggcccacatggacgagatcgggctggttgtagaccacgtcgagaaggagggcttt
ctaaggtttaggccgatcggcggctggaacgaggtgacgctgctcggccagcgggtgtgg
gtgaggactcaagatgggaggtgggtcaggggggtcgtaggcgttacgccgccgcatgtg
accccctccggccacgagagggaggccccggagatgaaagacctctacatagacgtgggg
gctagaagcagggaggaggccgagaagatgggcatctccgtcggctccgtggccgtcctc
gagagggagctggccgtcttaaacgggagggttgcgacgggcaaggccttcgacgacagg
gtgggcctcgccgttatgttgtacaccctgcggcaacttggcgacctccccgtgacccta
tacgccgtcgccacggtgcaggaggaggtgggcctccggggggcccagatagcggcggat
cggatagccccccactacgcggtggccctagacaccaccatagccgccgacgtgccgggt
gtaggcgagaggctacacgtgactaagctgggcgcggggcccgccataaaggtaatcgac
ggcggccgcggcggcctcttcatagcgcaccccgggctgagggaccacatcgtgaaaatc
gccagggaggccggcatcccccaccagcttgaggtgctatacggcggcaccacagacgcc
atggccatagcctttaggcgggagggcgtgcccgccgccgccatctccatacccacgcgc
tacgtccactcgccggtggagctggtggatctgtcagacgcgttgaacgcgtcgcggcta
ctcaagcaggtgcttgagaaaacgacgccggcggcggtggagaagttcctggagaggagg
gtgaagtga

DBGET integrated database retrieval system