KEGG   Pyrobaculum neutrophilum: Tneu_0616Help
Entry
Tneu_0616         CDS       T00682                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tne  Pyrobaculum neutrophilum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tneu_0616
   01230 Biosynthesis of amino acids
    Tneu_0616
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tneu_0616
   00051 Fructose and mannose metabolism
    Tneu_0616
   00562 Inositol phosphate metabolism
    Tneu_0616
Enzymes [BR:tne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tneu_0616
Exosome [BR:tne04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tneu_0616
  Exosomal proteins of bladder cancer cells
   Tneu_0616
  Exosomal proteins of melanoma cells
   Tneu_0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
557846..558520
Genome map
AA seq 224 aa AA seqDB search
MRLPILIINFKAYAEAAGRRALEIAKAAERAARELGVNIAVAPNHLELALVAQSVDIPVY
AQGADVETPGAHTAHVAVDNVKEAGAAGLILNHSEAPLALSQLSRLAARAKAVGLDLVIC
APDPDTSLAAAALKPHAVAVEPPELIGTGRAVSRYKPEAVVQTVEKVSRHFPDVAVITGA
GIESGEDVAAALKLGTRGVLLASAAVKAKDHYQKILELAKPLAD
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaggctccccatcttgatcataaacttcaaggcctacgccgaggccgccggcaggcgg
gctctggagatagcaaaggccgcggagagagccgccagagagctgggggtaaacatagcg
gttgcccccaaccacctggagctagcgctggtggcccagtccgtcgacatcccggtatat
gcccaaggcgccgatgtcgagacgccgggggcgcacacggcgcatgtggccgtggacaac
gttaaagaggctggggcggcgggcctcatcttgaaccacagcgaggcccccctcgccctc
agccagctgtctaggctagcggctagggcaaaagccgtgggtctagacctggtgatatgt
gccccggaccccgacacgtccctcgccgcggccgccctaaagccgcacgccgtcgccgta
gagccccccgagctcataggcacggggagggcggtctctaggtacaagcccgaggccgtg
gtgcagaccgtggaaaaggtgtcgaggcacttcccagatgtggctgttataacgggcgcc
ggcatagagtccggcgaggacgttgccgcggccctcaagctaggcaccagaggcgtactg
ctcgccagcgccgccgtcaaggccaaggaccactaccagaagatcctcgagctggcgaag
cctctggccgattaa

DBGET integrated database retrieval system