KEGG   Pyrobaculum neutrophilum: Tneu_0616Help
Entry
Tneu_0616         CDS       T00682                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tne  Pyrobaculum neutrophilum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tneu_0616
   01230 Biosynthesis of amino acids
    Tneu_0616
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tneu_0616
   00051 Fructose and mannose metabolism
    Tneu_0616
   00562 Inositol phosphate metabolism
    Tneu_0616
Enzymes [BR:tne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tneu_0616
Exosome [BR:tne04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tneu_0616
  Exosomal proteins of bladder cancer cells
   Tneu_0616
  Exosomal proteins of melanoma cells
   Tneu_0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
557846..558520
Genome map
AA seq 224 aa AA seqDB search
MRLPILIINFKAYAEAAGRRALEIAKAAERAARELGVNIAVAPNHLELALVAQSVDIPVY
AQGADVETPGAHTAHVAVDNVKEAGAAGLILNHSEAPLALSQLSRLAARAKAVGLDLVIC
APDPDTSLAAAALKPHAVAVEPPELIGTGRAVSRYKPEAVVQTVEKVSRHFPDVAVITGA
GIESGEDVAAALKLGTRGVLLASAAVKAKDHYQKILELAKPLAD
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaggctccccatcttgatcataaacttcaaggcctacgccgaggccgccggcaggcgg
gctctggagatagcaaaggccgcggagagagccgccagagagctgggggtaaacatagcg
gttgcccccaaccacctggagctagcgctggtggcccagtccgtcgacatcccggtatat
gcccaaggcgccgatgtcgagacgccgggggcgcacacggcgcatgtggccgtggacaac
gttaaagaggctggggcggcgggcctcatcttgaaccacagcgaggcccccctcgccctc
agccagctgtctaggctagcggctagggcaaaagccgtgggtctagacctggtgatatgt
gccccggaccccgacacgtccctcgccgcggccgccctaaagccgcacgccgtcgccgta
gagccccccgagctcataggcacggggagggcggtctctaggtacaagcccgaggccgtg
gtgcagaccgtggaaaaggtgtcgaggcacttcccagatgtggctgttataacgggcgcc
ggcatagagtccggcgaggacgttgccgcggccctcaagctaggcaccagaggcgtactg
ctcgccagcgccgccgtcaaggccaaggaccactaccagaagatcctcgagctggcgaag
cctctggccgattaa

DBGET integrated database retrieval system