KEGG   Pyrobaculum neutrophilum: Tneu_1176Help
Entry
Tneu_1176         CDS       T00682                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tne  Pyrobaculum neutrophilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tneu_1176
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tneu_1176
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tneu_1176
Enzymes [BR:tne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tneu_1176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1066202..1067458
Genome map
AA seq 418 aa AA seqDB search
MVDRWYNIAADLPGVLAPPKDPDEGESRIALLTRILPSALIDQEFTAERWVPIPEEVRGV
YRRVGRPTPLLRAEGFERALGTKVHIYYKYEGVLPVGSHKLNTAVAQAYYAKADGAVEVA
TETGAGQWGMAVSLAAALFGLKATVFMTRSSYNSKRQRLVFMRAYGATVYPSPSEVTETG
RRHFRPDHPGSLGIAISEAVEYVLSGERRRYLPGSVLEFVLLHQTVIGLEAMGQLPEEPD
YAVACVGGGSNFGGFTYPMLGAKLRGEGFGKTKFLAVESAAAPKLTRGEYRYDFPDATGI
LPLIKMYTLGHDYVPPPVHAAGLRYHGAAPSLSLLKRLGHVEAVAYGQEEVMEAALLFAR
SEGFLPAPESAHAVKAVADLARKLPPGSVVVFNMSGHGLLDVDSYEKALSWDKLYKQG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggtagaccgctggtacaacatcgccgctgatctgcccggggtcctcgctcctcctaag
gatcctgacgagggtgagagcagaatcgctcttctcaccaggatcctgccctccgcgctg
attgaccaggagttcaccgcagagaggtgggtgcccatacctgaggaggtgaggggggtc
tataggcgggtgggcaggcctaccccccttctgagggcggaggggtttgagcgggcgctt
gggacaaaggtgcacatttactacaagtacgagggggttctgccggtgggtagccacaag
ctcaacaccgccgtggctcaggcctactacgcgaaggcggatggggctgtggaggtggct
actgagacgggggcggggcagtgggggatggctgtgtccctcgccgcggcgctcttcggc
ctcaaggcgacggtcttcatgacccgctcctcctacaacagcaagaggcagaggctggtc
ttcatgagggcatacggcgccaccgtctacccaagccccagcgaggtgaccgagacgggg
aggaggcacttccggcccgaccacccggggtccctcggcatagccatatctgaggccgtg
gagtacgtcctctcgggggagaggaggaggtatctgccgggtagcgtcctggagttcgtc
ctcctccaccagacggtcataggccttgaggccatggggcagttgcccgaggagccggac
tacgcggtggcctgcgtcggcggggggtccaacttcggcggttttacatacccgatgctt
ggggctaagctcaggggggaggggtttggaaaaaccaagttcctcgccgtggagtcggcc
gccgcccccaagctgacgcggggggagtataggtacgatttcccagacgccacggggata
ctgccgttgatcaagatgtacaccctaggccacgactacgtccccccgcctgtccacgcg
gcgggtctgcgctaccacggggccgcccccagcctctctctgcttaaacggctgggccat
gtggaggcggtggcctacggccaggaggaggtgatggaggcggctctgctcttcgcgagg
tcagagggcttcctcccagcgcctgagtcggcgcacgccgtgaaggccgtggcggatctc
gcgaggaagctgccgccggggtccgtggtggtcttcaacatgtccggccacgggcttcta
gacgtcgactcgtacgagaaggcgttgagctgggataaactttataaacagggctaa

DBGET integrated database retrieval system