KEGG   Pyrobaculum neutrophilum: Tneu_1180Help
Entry
Tneu_1180         CDS       T00682                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tne  Pyrobaculum neutrophilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tneu_1180 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tneu_1180 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tneu_1180 (trpA)
Enzymes [BR:tne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tneu_1180 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1070303..1071010
Genome map
AA seq 235 aa AA seqDB search
MRRPGLGVYILAGWPNAEVFKRALTAVGEVADFVELGLPSRNPKYDGPYIRRAHREAEPS
AVEAAPGETYVMAYWEDFAGEPQRLFDAARAAGARGVLAPDLLIDFPGDLDRYVELTRRY
GLEPAFFIPSKFPYALLRRLASLKPAFIYLGLYAATGIELPVYVERNIKTVREVAPDVYL
VAGFAIDSPRKAAAVVEAGADAVVVGTAFLRRLRNSVEEAIAFLKEIRGALYLQQ
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggcccggcctcggcgtatatatactggcgggctggcccaacgctgaggttttc
aagagggcgcttaccgccgtgggcgaggtggccgacttcgtggagctgggtctaccgagt
agaaacccgaagtacgacggtccctacatcaggcgggcgcatagggaggcggagccctct
gcggtggaggcagcgcccggcgagacgtacgtaatggcctactgggaagacttcgccggg
gagccccagaggcttttcgatgcggcgcgtgcggcgggggctaggggggtcctcgccccg
gatctcctcatcgacttccccggcgatctagaccgctacgtggagctgaccaggaggtac
gggctggagccggccttcttcatacccagcaagttcccctacgcgttgcttaggcgcctc
gcctctctaaagccggccttcatatacctcgggctgtacgccgcaaccggcatagagcta
ccggtctacgtcgagaggaacataaagactgttagggaggtggcgcccgatgtctacctc
gtggctggcttcgccatagacagccctaggaaggccgccgccgtggtggaggcgggggca
gacgccgtggtggtggggacggccttcctaagaaggcttagaaactcggtggaggaggcc
atcgccttcctcaaggagataaggggggcgttgtacctacagcagtag

DBGET integrated database retrieval system