KEGG   Pyrobaculum neutrophilum: Tneu_1180Help
Entry
Tneu_1180         CDS       T00682                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tne  Pyrobaculum neutrophilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tneu_1180 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tneu_1180 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tneu_1180 (trpA)
Enzymes [BR:tne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tneu_1180 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1070303..1071010
Genome map
AA seq 235 aa AA seqDB search
MRRPGLGVYILAGWPNAEVFKRALTAVGEVADFVELGLPSRNPKYDGPYIRRAHREAEPS
AVEAAPGETYVMAYWEDFAGEPQRLFDAARAAGARGVLAPDLLIDFPGDLDRYVELTRRY
GLEPAFFIPSKFPYALLRRLASLKPAFIYLGLYAATGIELPVYVERNIKTVREVAPDVYL
VAGFAIDSPRKAAAVVEAGADAVVVGTAFLRRLRNSVEEAIAFLKEIRGALYLQQ
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggcccggcctcggcgtatatatactggcgggctggcccaacgctgaggttttc
aagagggcgcttaccgccgtgggcgaggtggccgacttcgtggagctgggtctaccgagt
agaaacccgaagtacgacggtccctacatcaggcgggcgcatagggaggcggagccctct
gcggtggaggcagcgcccggcgagacgtacgtaatggcctactgggaagacttcgccggg
gagccccagaggcttttcgatgcggcgcgtgcggcgggggctaggggggtcctcgccccg
gatctcctcatcgacttccccggcgatctagaccgctacgtggagctgaccaggaggtac
gggctggagccggccttcttcatacccagcaagttcccctacgcgttgcttaggcgcctc
gcctctctaaagccggccttcatatacctcgggctgtacgccgcaaccggcatagagcta
ccggtctacgtcgagaggaacataaagactgttagggaggtggcgcccgatgtctacctc
gtggctggcttcgccatagacagccctaggaaggccgccgccgtggtggaggcgggggca
gacgccgtggtggtggggacggccttcctaagaaggcttagaaactcggtggaggaggcc
atcgccttcctcaaggagataaggggggcgttgtacctacagcagtag

DBGET integrated database retrieval system