KEGG   Pyrobaculum neutrophilum: Tneu_1302Help
Entry
Tneu_1302         CDS       T00682                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tne  Pyrobaculum neutrophilum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tneu_1302
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tneu_1302
   00052 Galactose metabolism
    Tneu_1302
   00500 Starch and sucrose metabolism
    Tneu_1302
   00520 Amino sugar and nucleotide sugar metabolism
    Tneu_1302
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tneu_1302
   00524 Butirosin and neomycin biosynthesis
    Tneu_1302
Enzymes [BR:tne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tneu_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1160090..1160983
Genome map
AA seq 297 aa AA seqDB search
MAERYLGVDIGATWTRVLLVDREGRVLRRAKFRTGVDPAAQVVEAVSGWEFDAVGVGSIG
PLDLRSGWVVNSPNSPARRFPLVEPLKALGKPVAVANDCVAAVWGERVFKYGVENMVYVT
LSTGVGVGAIVDGTLLLGKDGNAHELGHAVIQFMEGRRCGCGGRGHFEAYVGGAHIPSLY
RELTGDDPLDPAEIFRRYREGEERARRFVDLWLEALAAGLATVAAAYDPELLIMGGSIAL
NNWDLISREVPRRLRAYLGVRPPELLQASFGDDEVAVGAAALVYKVPESLRRFGYPR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcggagagatacctcggagtcgacataggggcgacctggacgcgggttctcctggta
gatagggagggccgggtcctgaggagggccaagtttagaaccggcgtagatccggcggct
caggttgttgaggccgtctcggggtgggagttcgacgcggtgggggtgggctccataggg
cctctcgacttacggagcggctgggttgtgaattccccaaactcgccggcgaggcgtttt
ccgctcgtcgagcctcttaaggcgttgggaaagccggtggccgtggctaacgactgcgta
gctgccgtctggggcgagcgcgtgtttaaatacggcgtggagaacatggtttacgtcacg
ctgtcgacgggggtgggagttggggcaatcgtcgacggcactctgctcctcgggaaagac
gggaacgcccacgagctgggccacgccgtgatccagttcatggaggggaggcggtgcgga
tgtggggggcgtggacacttcgaggcgtatgtaggcggcgcccacataccctctctctac
cgcgagcttactggggacgacccgctggaccccgccgagatcttcagaagatacagagag
ggggaggagagggcaaggcggttcgtagatctctggcttgaggcccttgcagctggctta
gccacagtagccgcggcctacgaccccgagctacttatcatggggggatccatagccttg
aacaactgggacttgataagccgggaggtgccgaggaggctcagggcttatctgggcgtg
aggccgccggagcttctccaggcctcctttggcgacgacgaggttgccgtgggggccgcc
gcgcttgtgtataaagtccccgagagcttgaggaggtttggatacccgaggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system