KEGG   Pyrobaculum neutrophilum: Tneu_1463Help
Entry
Tneu_1463         CDS       T00682                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tne  Pyrobaculum neutrophilum
Pathway
tne00020  Citrate cycle (TCA cycle)
tne00640  Propanoate metabolism
tne00660  C5-Branched dibasic acid metabolism
tne00720  Carbon fixation pathways in prokaryotes
tne01100  Metabolic pathways
tne01110  Biosynthesis of secondary metabolites
tne01120  Microbial metabolism in diverse environments
tne01130  Biosynthesis of antibiotics
tne01200  Carbon metabolism
Module
tne_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tneu_1463
   00640 Propanoate metabolism
    Tneu_1463
   00660 C5-Branched dibasic acid metabolism
    Tneu_1463
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tneu_1463
Enzymes [BR:tne01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Tneu_1463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp RimK
Motif
Other DBs
NCBI-ProteinID: ACB40388
JGI: Tneu1463
UniProt: B1Y9F9
Position
1303386..1304525
Genome map
AA seq 379 aa AA seqDB search
MHEYEAKELLAKYGVEIPPGRLALTPDEALKAAKEIGTPVVLKAQVVVAGRGKAGGIKVA
KTPEEAYELSKAMFGMNIKGLVVRKIYVTKYVEAEREMYLSLIIDRASRRYLFLASPVGG
VDIEEIAKASPEKIKRVYVDPAVGLREFHIRQIGLWLGFRPGTRQWQQISSIVQAMYRVM
VEYDAELVESNPLALTKDGDVIPLDARVIVDDNALYRHSDLEKALEEDPRDVTEFEAYAK
KIGFHYVELDGDIGIIGNGAGLTMSTMDLVYHFGGRPANFLDIGGGASREVVREAVKVLL
KHPRVRVVFINIFGGITRADEVALGVKDALAETGATKKIVVRLKGTNEEQGRAILSEVGV
PLFENAEEAAQRAVELARV
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttgcacgagtatgaggcaaaggagcttcttgctaaatatggcgtggagataccgcctggg
aggctggccctcacgcctgacgaggccctcaaagccgcgaaggagatagggacgccggtg
gtgctgaaggcgcaggtcgtggtggcggggagaggcaaggcgggggggatcaaggttgca
aaaacgccggaggaggcctacgagctctccaaggcgatgtttgggatgaacatcaagggg
cttgtggttcgcaagatctacgtaacgaaatacgttgaagccgagagggagatgtacctc
tcgctcataatagatagggccagcaggaggtacctcttcctggcctctccagtggggggc
gtagacatcgaggagatcgctaaggccagccccgagaagatcaagagggtttacgtggat
cctgccgtcggcttgagggagttccacataaggcagatagggctttggctcggcttcagg
ccaggcacgcggcagtggcaacagatctcctctatcgtgcaggccatgtatagggtgatg
gtggaatacgacgcggagctcgtggagtcaaacccgcttgcgttgacgaaagacggcgac
gtgatcccgctggacgcccgcgtcatagtagatgacaacgctctgtaccgacattccgat
ctggagaaggcgcttgaggaggaccccagagatgtcacggagttcgaggcctacgccaag
aagataggcttccactacgtcgagctagacggggacataggcataattggaaacggcgcg
ggtctcacgatgtctaccatggatctcgtctaccacttcggggggaggccggccaacttt
ttagatataggaggcggggccagcagggaggtggttagagaagccgtgaaggtgctcctc
aagcaccccagggtgcgggtggtatttataaacatcttcggcggcatcacgcgggccgac
gaagtagccttgggcgtcaaagacgccctcgcagagacgggggctacgaagaagatcgtg
gtgaggctcaaggggacaaacgaggagcaggggagggccatcttgtccgaggtcggcgta
ccgctgtttgaaaacgcagaggaggccgcccagagagccgtggagctggcgagggtatga

DBGET integrated database retrieval system