KEGG   Pyrobaculum neutrophilum: Tneu_1526Help
Entry
Tneu_1526         CDS       T00682                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
tne  Pyrobaculum neutrophilum
Pathway
tne00010  Glycolysis / Gluconeogenesis
tne00020  Citrate cycle (TCA cycle)
tne00620  Pyruvate metabolism
tne00633  Nitrotoluene degradation
tne00640  Propanoate metabolism
tne00650  Butanoate metabolism
tne00680  Methane metabolism
tne00720  Carbon fixation pathways in prokaryotes
tne01100  Metabolic pathways
tne01120  Microbial metabolism in diverse environments
tne01130  Biosynthesis of antibiotics
tne01200  Carbon metabolism
Module
tne_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
tne_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tneu_1526
   00020 Citrate cycle (TCA cycle)
    Tneu_1526
   00620 Pyruvate metabolism
    Tneu_1526
   00640 Propanoate metabolism
    Tneu_1526
   00650 Butanoate metabolism
    Tneu_1526
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tneu_1526
   00680 Methane metabolism
    Tneu_1526
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tneu_1526
Enzymes [BR:tne01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tneu_1526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N E1_dh Amidohydro_2 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: ACB40450
JGI: Tneu1526
UniProt: B1Y9M1
Position
complement(1358429..1359334)
Genome map
AA seq 301 aa AA seqDB search
MTFRLDQLPKKRYVIPGNAACAGCGMMIGLKILGMALGDESVLVIPASCASVVQGLAPKT
GLAFPILNVPFASSAAVATGIAEAYKALGVRGHVVVWAGDGGTADIGFATLSGAAERNSN
VIYVMYDNEAYMNTGIQRSSSTPRSAWTTTTPSGKRERRKDVALLMAMHGVPYVATASIA
YPHDFYRKLKRAAEVEGFRFIHLQTPCPPGWRFDPAKTVEVARLAVETGAWILWEYDKGV
LKVNPPSDRFADKSKRRPLVEYVKLQGRFAHLSESDIKALEEEIEERWRLILALSSALNQ
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaccttccgattggatcaactccccaagaagcgctacgtcatacccggcaacgccgca
tgcgccggttgcggtatgatgataggtctaaagatactgggcatggcactgggcgacgaa
tcggtgcttgtaataccggcgagttgcgcctccgttgtgcagggcctggcgcctaagacc
ggcctcgcattccctatcttaaacgtgcccttcgcctcctcggcagccgtagccacaggc
atagccgaggcctacaaggcgctcggcgtaagaggacacgtggtggtgtgggctggcgat
ggggggaccgcggatataggcttcgccaccttaagcggcgccgcggagagaaatagcaac
gtgatctacgtgatgtacgacaacgaggcctacatgaacaccggcatacagcgcagtagc
tccacgccgcggagtgcttggacaacgactacgccgagcggcaaacgcgagaggaggaaa
gacgtcgccttgctcatggccatgcacggagtgccgtacgtggcaacggccagcatagcc
tatccacacgacttctacaggaagctgaagagagctgcggaagtggagggcttcaggttt
atacatctgcaaacgccgtgtcctccaggctggaggttcgatccggcgaagaccgtggag
gtggctagactcgccgtggagacgggcgcgtggatactctgggagtacgacaaaggggtg
ttgaaggtgaatccgccgagcgataggtttgccgataagtccaagaggaggcctcttgta
gagtatgtaaaactacaggggaggttcgcccatttgtccgaaagcgatataaaggccctc
gaggaggagatcgaggaaaggtggcgtctcatacttgcgctttctagcgccctcaaccag
cgttaa

DBGET integrated database retrieval system