KEGG   Pyrobaculum neutrophilum: Tneu_1528Help
Entry
Tneu_1528         CDS       T00682                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
tne  Pyrobaculum neutrophilum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tneu_1528
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tneu_1528
   00020 Citrate cycle (TCA cycle)
    Tneu_1528
   00620 Pyruvate metabolism
    Tneu_1528
   00640 Propanoate metabolism
    Tneu_1528
   00650 Butanoate metabolism
    Tneu_1528
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tneu_1528
   00680 Methane metabolism
    Tneu_1528
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tneu_1528
Enzymes [BR:tne01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tneu_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1360476..1360745)
Genome map
AA seq 89 aa AA seqDB search
MRNQDLSVLPISKPAPASAGATGTWRTYKPVVDLAKCVDCGICWLYCPESVIEWEKGRKI
AIDYMYCKGCGICADVCPVKAISMEPEGT
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaccaagatcttagtgtgttacctatttcgaagcccgcgcccgcctcggcgggc
gccactggaacttggcgcacgtacaagcccgtggtggatttggccaaatgcgttgactgc
ggcatctgttggctttactgtcccgagtctgtaatagagtgggaaaaaggccgcaagatc
gcgatcgattatatgtactgcaaaggctgtggaatatgcgctgatgtgtgcccagtaaaa
gcaatctctatggagcctgaggggacatga

DBGET integrated database retrieval system