KEGG   Pyrobaculum neutrophilum: Tneu_1796Help
Entry
Tneu_1796         CDS       T00682                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tne  Pyrobaculum neutrophilum
Pathway
tne00010  Glycolysis / Gluconeogenesis
tne00020  Citrate cycle (TCA cycle)
tne00620  Pyruvate metabolism
tne00633  Nitrotoluene degradation
tne00640  Propanoate metabolism
tne00650  Butanoate metabolism
tne00680  Methane metabolism
tne00720  Carbon fixation pathways in prokaryotes
tne01100  Metabolic pathways
tne01120  Microbial metabolism in diverse environments
tne01130  Biosynthesis of antibiotics
tne01200  Carbon metabolism
Module
tne_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
tne_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tneu_1796
   00020 Citrate cycle (TCA cycle)
    Tneu_1796
   00620 Pyruvate metabolism
    Tneu_1796
   00640 Propanoate metabolism
    Tneu_1796
   00650 Butanoate metabolism
    Tneu_1796
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tneu_1796
   00680 Methane metabolism
    Tneu_1796
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tneu_1796
Enzymes [BR:tne01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tneu_1796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C IMS_C
Motif
Other DBs
NCBI-ProteinID: ACB40714
JGI: Tneu1796
UniProt: B1YB14
Position
complement(1575340..1576548)
Genome map
AA seq 402 aa AA seqDB search
MTAQALVPREKKIAQKRIALTGNHAVALAVKMCRPEVIAAYPITPQTPVVEKLAEYVNNG
ELDAEYIPVESEHSAMSASIGASAMGARTFTETSSQGLMHMYENLPIAVGLRLPIVMGVA
ARTISAPINVWGDYSDVMTMRELGWIIYIVQNAQEAFDTIIQAYRVAEDQRVHLPAVVAY
DGFWTSHVLQPLDVPEDEEDVMRFAPITRSWVKLDVDNPLQLGAVGTPEWYWEVRWQAAE
ALRESLKVVEEVDREFGKWFGRSYGLFHTYRLEDAELAIVTYGSIYGLVKKVVDRLREEG
VKAGALRLRVIRPWPGHQLRKALDRVDKVFVIDRAINHGGPLIGPMATEVAATLQRPVYN
ALATIGMRAIDSDMIYEAALKVAKGLWAPNQTYTIGLRGGYE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacggcccaagccctagtcccgagagagaagaagatagcccagaagaggatagcgctg
acgggcaaccacgccgttgccctagccgtcaagatgtgtagacccgaggtcatcgcggcc
tacccaatcactccgcagaccccagtggtggagaagttggccgagtatgtaaacaacggc
gagctagacgccgaatatataccagtggagagcgaacacagcgcgatgtctgcctccata
ggcgcctccgccatgggcgcccgtaccttcacagagacctcctcccaaggcctaatgcat
atgtacgaaaacctccccatcgccgtaggtttaagattaccgatagtcatgggggtagcg
gcgaggacgatatctgcgcctattaatgtatggggcgactacagcgatgtgatgaccatg
agagagttaggctggatcatatatatagtccaaaatgcccaagaggcctttgatacgatt
atacaggcataccgcgttgcagaagaccagagggtccacctacccgccgtggtggcctac
gacggcttctggaccagccacgtcctccagccgctcgacgtgccggaggacgaggaggac
gtcatgaggtttgcccccatcaccagatcttgggttaagctagacgtggacaacccgctc
cagctaggcgccgtgggaacgccggagtggtactgggaagtgaggtggcaggccgcagag
gcgctgagggagtctctcaaggttgtagaggaggtggatagagagtttggcaagtggttc
ggcaggagctacggcctcttccatacatacaggctggaggacgccgaactcgccatagtg
acctacggctccatatacggcttggtgaagaaggtagtagataggcttagggaggagggc
gtcaaggccggcgccttgagactacgcgtcattaggccctggcccggccaccagttacgt
aaggcccttgacagagtagataaggtcttcgtaatagatagggcgatcaaccacggcgga
cctcttatagggccaatggcaactgaggttgcagctactctgcagaggcctgtctacaac
gcgttggcgactatcggcatgagggcaatagacagcgacatgatatatgaggcggctctg
aaggtggccaaggggctgtgggcccccaaccagacctacacaatcggcttgaggggcggc
tatgagtag

DBGET integrated database retrieval system