KEGG   Pyrobaculum neutrophilum: Tneu_1797Help
Entry
Tneu_1797         CDS       T00682                                 

Definition
pyruvate ferredoxin oxidoreductase subunit gamma/delta
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
tne  Pyrobaculum neutrophilum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Dicarboxylate-hydroxybutyrate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:tne01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tne00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tne00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tne00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tne00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tne00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:tne00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:tne00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:tne00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1576545..1577483)
Genome map
AA seq 312 aa AA seqDB search
MRVETIWLGRGGQGIVTATYIVANAAVIDGFYAIANPEFGAERRGAPVKAFLTIDKNPIE
DQEPIKTPDVAIIFDDKLIDPMRFAIDAVKPGGYVIVNSAKQPEEVRKLVGRNDVYVVVL
DAVGIAMKHVGLPVPNGPLAGAFSKVMGFPRLESIKTAFENQLGKAVEENFAATKEAYEV
AVVLKPEKVDASAKPKGVISTTSAFLTGPYELVGWQQVNKGGAVGPGSSLPYLTGGWRIE
KPIIDHSKCIMCRKCWLYCPDDAIIEAWREAPGPRGRVFRTKAIDFDYQYCKGCGVCAEV
CPTGAIQMVREI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcgggttgagacgatctggcttggccgcgggggccagggcatcgtcacggccacctac
atagtcgccaacgccgccgtgatagacggcttctacgccattgccaaccctgagttcggc
gcggagaggagaggcgcgcccgtcaaggccttcctcacgatagataaaaaccccatcgag
gatcaggagccgattaagactcccgacgtcgccatcatattcgacgacaagctcatcgac
cccatgaggttcgccattgacgccgtgaagcccggcggctacgtcatcgtaaacagcgct
aagcagcccgaggaggtgcggaagctggtggggagaaacgacgtctacgtggtggtgcta
gacgctgtcggcatcgccatgaaacacgtgggtctccccgtgcccaacggcccgctggct
ggcgccttttccaaggtgatgggcttccccaggcttgagtcgataaaaaccgcgtttgag
aaccagctgggcaaggccgttgaggagaacttcgccgccacgaaggaggcctacgaggtg
gccgttgtcctcaagcccgagaaggtggacgcctccgcgaagccgaaaggggtaatatcc
accacgtcggccttcctaaccgggccctacgagcttgtgggctggcaacaggtgaataaa
ggcggcgccgtcggccccggcagtagcttgccgtatctcacaggcggctggaggatagag
aagcccattatagaccactccaagtgtataatgtgtaggaagtgctggctgtattgtcca
gacgacgccataatagaggcttggagggaggcgccggggcctagaggccgcgtctttagg
accaaggccatcgacttcgactaccagtactgcaaggggtgtggtgtctgcgcagaggtc
tgcccaacaggggcaatacagatggtgagggagatatga

DBGET integrated database retrieval system