KEGG   Pyrobaculum neutrophilum: Tneu_1839Help
Entry
Tneu_1839         CDS       T00682                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tne  Pyrobaculum neutrophilum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tneu_1839
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tneu_1839
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tneu_1839
Enzymes [BR:tne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tneu_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1617017..1618237
Genome map
AA seq 406 aa AA seqDB search
MPPHIGPLFKSFHIQKGYKERFFSGHGRFGDNPYLKCISCGATYAQDYRLYRCPKCGGLL
DVVVPGKYWAPKGRGLWRYATMLPLRDGVSLGEGQTPLVKSNLDGHLYVKFEGANPTGSF
KDRGMALGVTVAKESGASKVVVASTGNTAASAAAYAARAGLKCYVVLPRGNVARGKLMQA
ALHGAELLMVSGLFDKALEYVVTHGTRYAYPLNSFNPWRLEGQKTLAFEVYEELGCPDYV
VVPVGNAGNIAAIWKGFKELGELGLCKKLPKMVGVQAEGAAPLANAWQRGLKEPLFIDEP
ETVATAIKIGKPINWPKAMAAVRESGGFFIAVSDGEILKAQRLLASRDGIGAEPAGAASV
AAALKLKLNGTVVAVVTGHALKDPDAVEINAREVRNAEELVELLEK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgccaccccacataggtcctctatttaaatcttttcacatccaaaaaggttataaggag
aggtttttctccgggcatggccgtttcggggacaatccctacctcaagtgcataagttgc
ggggcaacctacgcccaagactaccggctctaccggtgcccaaaatgcggcggtctcctc
gacgtggttgtgccggggaagtactgggcgccaaagggcagaggcctctggcgctacgcc
accatgctaccccttagagatggggtatccctcggcgagggtcagacccccctcgtcaaa
tccaacctagacggccacctatacgtcaagttcgagggggccaaccccaccggtagcttc
aaggaccggggcatggcgctgggcgtcacggtggctaaagaaagcggcgcgtcgaaggtc
gtagtggcctccaccggaaacaccgccgcctcagcggccgcctacgccgccagagccggg
ctgaagtgctacgtggttctgccgaggggcaacgtggctagaggcaagctcatgcaggcg
gcgctacacggagccgagttgctcatggtgagcggcctcttcgacaaagcccttgaatac
gtggtaacccacggcaccaggtacgcgtatccgctgaacagcttcaacccctggaggctc
gaggggcagaagaccctggctttcgaggtgtacgaggagctcggttgcccagactacgtg
gtggtgcccgtcggaaacgccggcaacattgccgcgatatggaagggcttcaaggagttg
ggcgagctgggcctatgcaagaagttgcccaagatggtgggggtacaggcggagggggcc
gccccccttgccaacgcgtggcagagggggctcaaggagcctctcttcatcgacgagccg
gagaccgtcgccaccgccataaagatcggaaaacctataaactggcctaaggccatggcg
gccgtgcgggagtcaggcggcttcttcatagctgtttcagacggcgagatactcaaagcg
cagaggctactcgcgtcgagagacggcataggggctgagccggccggcgccgcgtcggtc
gcggcggcgctgaagctgaagctaaacggcaccgtggtggcggttgtcacaggacacgcc
cttaaggacccagacgccgtggagataaacgctcgggaggtgagaaacgccgaggagctc
gtcgagctgttggagaaatga

DBGET integrated database retrieval system