KEGG   Pyrobaculum neutrophilum: Tneu_1986Help
Entry
Tneu_1986         CDS       T00682                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tne  Pyrobaculum neutrophilum
Brite
Enzymes [BR:tne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Tneu_1986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1748737..1749360
Genome map
AA seq 207 aa AA seqDB search
MAHRLVEELVREGVIKSESVRRAMLAVPREEFVMPEYRMMAYEDRPLPLFADATISAPHM
VAMMCELVEPKPGMKILEVGAGSGYQAAVCAEAMERRGRVYTVEIVKELAIYAAQNIERL
GYWGVVEVYHGDGRSGLERHAPFDAIIVTAAARQIPPALVRQLKEGGTLVIPLVEHMGQI
LYKVTKRGERVEKRAVTYVLFVPLRES
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcgcataggctcgtggaggagctggtgcgcgagggcgtcataaagagcgaaagcgtc
agaagagccatgttggctgtgccgcgggaggagttcgtcatgcctgagtacaggatgatg
gcctacgaggataggccgcttccgctgtttgcagacgccaccatatcggctccgcatatg
gtcgccatgatgtgcgaacttgtggagcccaagccaggaatgaagatccttgaggtgggc
gccggctccggctaccaagccgccgtatgtgcggaggctatggaaaggcggggtagggtc
tatacggtggagattgtgaaggagcttgccatctacgcggcgcagaacatagagcggttg
gggtactggggcgtggtagaggtctaccacggagatggtagaagcggcctcgagcgccat
gcccccttcgacgccattatcgttacggctgcggctaggcagataccgcctgcgctcgtt
agacagctcaaggagggggggaccttggttatcccgttggtggaacacatgggccagatt
ttatacaaggtgactaagaggggtgagagggtggagaagcgcgccgttacctacgtcttg
tttgtgccgctacgcgagagctag

  All links  
No link information was found.   
DBGET integrated database retrieval system