KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00022591G001Help
Entry
GSTEN00022591G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:tng00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    GSTEN00022591G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     GSTEN00022591G001
Peptidases [BR:tng01002]
 Serine Peptidases
  Family S33
   GSTEN00022591G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
9
AA seq 328 aa AA seqDB search
MNALTAVTCLLAAAKPPCPSREQSPRRSPQGVPYSDLRHIVNADGLHLFCRYWEPRSPPR
ALVFIAHGAGEHCGPYDELAQRLKELSVLVFAHDHVGHGQSEGERMNIKDFQIYVRDSLQ
HIDLMKSRHPDLPVFIVGHSMGGAISILTACERPTEFAGVVLIAPLVQMNPESATPFKVF
LAKVLNHMMPSLTLGSIESKWVSRDQKQVEAYDADELNFHGGLRVSFGMQLMAATARIEA
EIPSIKWPFLLLHGDADKLCDMRGSTMMYENTPSSDKKIKIRQRRVSLIASPVSPDQIFE
GGYHCLHHDLPEVAESVLKEVSGWISER
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgctgacggccgtcacctgcctgctggccgccgccaagcctccatgcccgagc
cgggagcagagtccgcggcggagcccgcagggagttccctacagcgacctgcggcacatc
gtcaacgccgacggactgcacctgttctgccgctactgggagccccgcagcccgccgagg
gcgttggtcttcatcgctcacggggctggagagcattgtggaccctacgatgagctcgca
cagagactgaaggaactctccgtgctggtgtttgcgcatgaccacgtcggccacggtcag
agtgaaggagaacgcatgaacatcaaggacttccagatttacgtacgagactccctgcag
cacatcgacctgatgaaatcccgccacccggacctgcccgtcttcatcgtgggccactct
atgggaggcgccatctccatcctgacagcatgtgagcggcccaccgagttcgctggagtg
gttctgatcgcaccgctggtccagatgaacccagagtcggccactccgttcaaggtgttt
ctggcgaaggtcctgaaccacatgatgcccagcctgactctggggtctatcgagtctaaa
tgggtctctcgggatcagaagcaggtggaggcgtacgacgcggatgagctgaacttccac
ggcggcctacgcgtgtctttcggcatgcagctgatggcggcgacggcgcgcatcgaggcg
gagatcccgtccatcaagtggcccttcctgctgctgcacggcgatgctgacaaactctgc
gacatgaggggttccaccatgatgtacgagaacactccgagctccgacaagaaaatcaag
atccgacagcgccgcgtgtccctgatcgcctctcctgtttcccccgatcagatcttcgag
ggaggctatcactgccttcaccacgacctccccgaagtcgccgagtccgtgctgaaggag
gtgagcggctggatctcggagcgc

DBGET integrated database retrieval system