KEGG   Thioalkalivibrio nitratireducens: TVNIR_0061Help
Entry
TVNIR_0061        CDS       T02408                                 

Gene name
xanA_[H]
Definition
Phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVNIR_0061 (xanA_[H])
   00030 Pentose phosphate pathway
    TVNIR_0061 (xanA_[H])
   00051 Fructose and mannose metabolism
    TVNIR_0061 (xanA_[H])
   00052 Galactose metabolism
    TVNIR_0061 (xanA_[H])
   00500 Starch and sucrose metabolism
    TVNIR_0061 (xanA_[H])
   00520 Amino sugar and nucleotide sugar metabolism
    TVNIR_0061 (xanA_[H])
  Nucleotide metabolism
   00230 Purine metabolism
    TVNIR_0061 (xanA_[H])
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TVNIR_0061 (xanA_[H])
Enzymes [BR:tni01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TVNIR_0061 (xanA_[H])
    5.4.2.8  phosphomannomutase
     TVNIR_0061 (xanA_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
48544..49899
Genome map
AA seq 451 aa AA seqDB search
MNDLSCFMPYDIRGRVPDDLDTALARDIGRAFVAEFGARRVVVGHDVRLESPALAAALST
GLADSGADVVDIGLCGTEEVYFGTVHQAADGGIMVTASHNPKGYNGMKLVRAGAVPVSGD
SGLLAIRDRIAARDLPPPGPPGRVMVNDDKTPYLQHLLGYIDPAALRPLKIVADPGNGGA
GPVVQRLAERLSPLEFVLIHEIPDGNFPNGVPNPLLPERRAATTEAVRMHGADFGIAWDG
DFDRCFLFDADGRFIEGYYLVGLLAEVMLRKYPGEKILHDPRLTWNTIEQVKAAGGQPVL
TKTGHAFMKERLRREDAVYGGEMSAHHYFRDFAYCDSGMIPWLLIAELISRSGRSLAELV
DARMAAFPCSGEINYRVPAVAPVLERVLAHFAPQHPGIDRTDGISVEFPDWRFNLRASNT
EPLLRLNVESRGDPGAVARHVQELASLIESR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacctctcgtgtttcatgccctacgacatccgcggccgggtgcccgatgatctc
gacacggcgctggcccgcgacatcggccgggctttcgtcgccgagttcggggcgcgccgg
gtcgtggtcggtcacgacgtgcgcctggaaagccccgcgctggcagcggcgctgtcgacc
gggttggccgacagcggcgcggacgtcgtcgacatcggcctgtgcggtaccgaggaggtg
tatttcggcacggtgcaccaggccgcggacggcgggatcatggtgaccgcgagccacaac
ccgaagggctacaacggcatgaagctggtgcgggccggcgcggtgccggtcagcggcgac
agtgggctgctcgcgatccgggatcgcatcgccgcgcgggatttgccgcccccggggccg
cccgggcgtgtgatggtgaacgacgacaagaccccgtacctccagcatctgctgggctac
atcgacccggcggccctgcggccgctgaagatcgtggccgatcccggcaatggcggcgcc
ggtccggtggtgcagcggctcgcggagcggctgtcgccgctggagttcgtgctgatccac
gagatccccgacggcaattttccgaacggcgtgccgaacccgctgctgcccgagcggcgc
gcggccaccaccgaggccgtgcgcatgcacggcgccgacttcggcatcgcgtgggacggt
gatttcgaccgctgtttcctgttcgacgccgacgggcgcttcatcgagggctattacctg
gtgggtctgcttgcggaggtgatgctgcgcaagtacccgggcgagaagatcctgcacgat
ccgaggttgacctggaataccatcgagcaggtgaaggccgccggcggccagccggtgctg
accaagaccggccatgccttcatgaaggagcgcctgcgccgcgaggacgcggtatacggt
ggggagatgagcgcgcatcactatttccgcgacttcgcgtattgcgacagcggcatgatt
ccctggctgctgattgccgaactgatcagccgcagcggccgcagcctggccgagctggtc
gacgcgcggatggcggcgtttccctgcagtggcgagatcaattaccgcgtgccggcggtg
gctccggtgctggagcgcgtgctcgctcatttcgcgccccagcacccgggaatcgaccgc
accgacgggatcagcgtggaattccccgactggcgcttcaacctgcgcgcgtccaacacg
gagccgctgctgcgtctgaacgtcgagtcgcgcggcgatccgggagccgtcgcgcggcat
gtccaggaacttgccagcctgatcgagagccgctga

DBGET integrated database retrieval system