KEGG   Thioalkalivibrio nitratireducens: TVNIR_0100Help
Entry
TVNIR_0100        CDS       T02408                                 

Gene name
hemY_[H]
Definition
Protoporphyrinogen IX oxidase, aerobic (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TVNIR_0100 (hemY_[H])
Enzymes [BR:tni01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TVNIR_0100 (hemY_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
84455..85789
Genome map
AA seq 444 aa AA seqDB search
MRTAIIGAGISGLTTAFYLLRERPDREVHVFDAAAIPGGTMRTVTQDGFHFEAGGNGFLT
NKPDSMQLAKDAGAQDLLMPSSDQARKRYIFTDRLHRLPESPGLFLRSKLIGFGDKLRVA
GEVFVSPRRRGGGEETLQEFGYRRVGKGFTDVFLDAMTAGIYATTPDRVSVNAAFPLVVR
LEQEHGGLFRGMLARRKKQAGPGGILMSFKSGVGTFIGHLRAQTPAQWHLGEPVTEVVRA
TSGYRVRAGDFEEGFDQVVVSTPSHAASAMLRRLDPDLSAGLAAIEYSPVAVVGLGWKEL
DHPLDGFGLLTTTSAGLPVLGVLWDSSIFPDRAPDGAKSVRVMIGGQRNPELVDQDEAGL
IATAREGLRLTMGVEREPDVSFVQRWDRGIPSYRVGHIAAVDALFKQLDRYPGLYLGGNA
YRGIAMNDCVRNGRELAERLAAAE
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcgtactgccatcatcggcgccggcatcagcggcttgaccacggccttctacctcctc
cgtgaacggccggaccgggaggtccacgtcttcgatgcggccgcgatcccgggcgggacg
atgcgcacggtcacgcaggacggatttcacttcgaggccgggggcaacggctttctgacc
aacaagcccgacagcatgcaactggccaaggatgccggggcgcaggatctgctgatgccg
agttccgaccaggcccgcaagcgctacattttcaccgaccggctgcaccggctgccggaa
tccccggggctgttcctgcgctcgaaactgatcgggttcggcgacaagctgcgcgtggcc
ggcgaggttttcgtgtcgccccggcgccgcggcggcggcgaggagactctgcaggagttt
ggctatcggcgcgtgggcaagggcttcaccgacgtgttcctggacgcgatgaccgccggc
atctatgcgaccaccccggatcgcgtctcggtgaacgcggcttttccgctagtcgtgcgc
ctcgagcaggaacacggcggactgttccgcggcatgctggcacggcgcaagaagcaggcc
ggccccggggggatcctgatgagcttcaagagcggggtgggcacgttcatcgggcatctg
cgcgcgcagaccccggcgcagtggcacctgggcgagccggtgaccgaggtcgtgcgcgcc
acttccggctaccgggtgcgtgccggtgatttcgaagaaggcttcgaccaggtcgtggtg
agcaccccgtcgcacgcggcttccgcgatgctgcggcggctggatcccgatctctccgcc
ggactcgccgcgatcgagtactcgccggtggcggtggtcgggctcggctggaaggaactc
gaccacccgctggacgggtttggtctgctgaccaccaccagcgcgggattgccggtgctt
ggagtgctctgggacagcagcatcttcccggaccgtgcccctgacggggccaagagcgtg
cgcgtgatgatcggcggccagcgcaaccccgaactggtcgaccaggacgaggcagggctg
atcgcgaccgcgcgcgaggggctgcgcctgacgatgggcgtcgagcgcgagccggacgtg
agcttcgtgcagcgctgggaccgcggcatcccgtcctatcgggtcggccacattgcggcg
gtggatgcgctgttcaagcaactcgaccgctaccccgggctgtatctgggcggcaacgcc
tatcgcgggatcgcgatgaacgactgcgtacgcaacggccgcgaactcgccgagcgtctc
gctgccgccgaatag

DBGET integrated database retrieval system