KEGG   Thioalkalivibrio nitratireducens: TVNIR_0101Help
Entry
TVNIR_0101        CDS       T02408                                 

Gene name
mutM_[H]
Definition
Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:tni00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    TVNIR_0101 (mutM_[H])
Enzymes [BR:tni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     TVNIR_0101 (mutM_[H])
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     TVNIR_0101 (mutM_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(85865..86680)
Genome map
AA seq 271 aa AA seqDB search
MPELPEVETTRSGLEPHLQGRRIRELVVREPRLRWPVPPELPAMLSGRQVRRLDRRAKYL
LLGTDGPGVLLHLGMSGSLRRCLPDAPLRPHDHLSFRLDDGFEIRLHDPRRFGCCLPLPD
PPRLHPLLSTLGPEPLGDAFDGDYLHYLSRGRRAPVKAFIMDQQVVVGVGNIYASEALFL
AAIRPGRAAGRVSRAEYRALATSVRSVLARAIAEGGTTLRDFVREDGTHGYFRQRLRVYG
REGQPCVSCATPIRTRRIGNRASSYCPACQR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactccctgaggtcgagacgacccgtagcggcctcgaaccccacctgcaggga
cgccggatccgggaactggtcgtgcgtgaaccgcggctgcgctggccggtgccaccggaa
ctcccggcgatgctctcggggcggcaggtgcgaaggctcgaccggcgcgcgaaatacctg
ctgctgggaaccgacggccccggcgtgctgctgcacctcgggatgtcgggaagcctgcgc
cggtgcttgccggacgccccgctgcgcccgcacgaccacctgagcttccggctcgacgac
ggcttcgagatccggctgcacgacccgcgccgcttcggctgctgcctgccgctaccggac
ccgccgcggctccacccgctgctgtcgacgctgggcccggaaccgctcggcgatgcgttc
gatggcgactacctccactacttaagccgcgggcgccgcgcgccggtgaaagccttcatc
atggaccagcaggtggtcgtcggcgtgggcaacatctacgccagcgaggcgctgtttctc
gccgccatccgtcccggacgggccgccggccgggtatcccgagccgaatatcgcgcgctc
gccaccagcgttcgcagcgtcctcgcccgggcgatcgccgaggggggcaccacgctgcgg
gacttcgtacgcgaggacggcacccacggctatttccgccagcgcctgcgcgtatacggc
cgcgagggccagccctgcgtttcctgcgcgaccccgatccgcacccgccgcatcggcaac
cgcgccagcagctactgccccgcctgccagcgctga

DBGET integrated database retrieval system