KEGG   Thioalkalivibrio nitratireducens: TVNIR_0138Help
Entry
TVNIR_0138        CDS       T02408                                 

Gene name
recD_[H]
Definition
Exodeoxyribonuclease V alpha chain (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tni00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TVNIR_0138 (recD_[H])
Enzymes [BR:tni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     TVNIR_0138 (recD_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
132334..134448
Genome map
AA seq 704 aa AA seqDB search
MSRPVAAAALASADALLDLLDRWVEHGWLRALDRALARFLREQVPEAAPLLLLGAALASH
QLGRGHACLDLEAALDAPDRTLSLPPDGEPGEDPPVRPAALLAPVTLQDWTASLDHPALV
APAAGATPLVLDRGRLYLRRLWECEQRIAESVAERVAWFSELRSGLDPAAMRTWLDHLFG
ARTEREIDWQRAACALAAAGAFGVITGGPGTGKTTTVVRLLALLQALQLERASALPLRIR
MAAPTGKAAARLNASVAGAVHALSLPDDECGARIRAAIPAEVSTVHRLLGSRPGSRRYRH
HAGNPLPLDVLVVDEASMIDMELMTSVVQALPTAARLILLGDKDQLASVEAGAVLGEICA
RAGAGHYSPATSRWLEAVSGERIPDRLRNPAGGPLDQHVVMLRRSYRFGESSAIGRLARS
VNAGDAEAARAIVSGSGALPDLAAVSLNGPEDAVFERYVLHGRDDAARDRRRDDLPTGQA
HYLRLMRSLDPGDDAVPDATNRWAGQVLDAHSGFQLLSAVRRGPWGVETLNRRIEAALRS
EGLIPSSGIWYAGRPVIVTANDYGLGLMNGDIGVTLARPMAEADGRRVRALRVAFPAGDG
SGRVRWFVPSRLVNVETVYAMTVHKAQGSEFDHAALLLPERENPVLTRELLYTAITRARC
WFTLIEPRAGVLEQAVRRRVLRGTGLGDALRGRMSGQHISGGGR
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgagccgacccgtggccgctgcggccctagcgtcggccgacgcgctgctggacctgctg
gatcggtgggtcgagcatggctggctgcgggccctagatcgtgcgctcgcacgcttcctg
cgcgagcaggtaccggaggccgcgccgctgctgctgctcggcgcggcactagcgagccat
caactgggccgggggcacgcctgcctggacctggaagcggcactggacgccccggaccgg
acgctgtcgctgccgccggatggcgaaccgggagaggatcccccggttcggccggcggcg
ctgctcgcgccggtcacgctgcaggactggaccgcatccctggatcacccggcactggtg
gcccctgccgccggggcgacgccgctggtgctggaccgcggccggctctacctgcgccgg
ctctgggaatgcgagcagcgtatcgcggagtcggtcgctgaacgcgtcgcctggttcagc
gagctgcgttccggtctggatccggccgcgatgcggacctggctcgatcacctgttcggg
gcccggacggagcgcgagatcgactggcagcgcgcggcctgcgcgctggcggcggccgga
gccttcggcgtaatcaccggcggaccgggcaccggcaagaccaccacggtggtgcgcctg
ctcgcgctgttgcaggcactgcagctcgagcgcgcgtctgcgttgccgctgcgcatccgc
atggccgcgcctacgggcaaggccgctgcccgcctgaacgcctcggtggccggcgccgtg
catgcgctcagcctgccggacgacgaatgcggggcgcggatccgcgccgcgatcccggcc
gaggtcagcacggtgcaccggctgctggggagccggcccggcagccgccggtaccggcac
catgcgggcaacccgctgccgctggatgtgctggtggtcgacgaggcgtcgatgatcgac
atggagctgatgacctccgtggtccaggcgctgccgaccgcggcgcggttgatcctgctg
ggggacaaagatcagctcgcatcggtggaggccggcgcggtgctcggcgagatctgtgca
cgcgccggtgccgggcattactcgcccgcgacgagccgctggctggaggcggtcagcggc
gagcggatccccgataggcttcggaacccggccggcggaccgctggaccagcacgtcgtg
atgctccggcgcagttaccgtttcggcgagagcagcgcgatcggccgtctggcccgctcg
gtgaacgcgggtgacgcggaggcggcccgggccatcgtgtcgggcagcggggcgttgccc
gatctcgccgcggtctcgctgaacggtcccgaggacgcggtattcgagcgctatgtgctt
cacggccgcgacgatgccgcgcgggaccgacgaagagacgacctgcccaccggtcaagcg
cactacctgaggctgatgcgcagcctggatccgggcgacgacgcggtgccggacgcgacc
aatcgctgggccgggcaggtcctggatgcgcattcggggtttcagctgctgagcgcggtg
cgccgtggcccctggggggtcgagacgctgaaccgccgcatcgaggccgcactgcgctcg
gagggcctgattccctcgagcgggatctggtacgcgggacgaccggtgatcgtgaccgcg
aacgactacgggctcggcctgatgaacggagatatcggggtcacgcttgcccgccccatg
gcagaggcggatggacgccgggtgcgtgcgctgcgcgtcgcgtttccggctggcgacggc
agcggccgggtgcgctggttcgtgccgagccggctggtgaacgtcgagacggtctacgcg
atgacagtgcacaaggcgcagggatcggagttcgaccacgcggccctgctgctgcccgag
cgtgagaacccggtcctgacgcgggaactgctgtacacggcgatcacgcgcgcgcggtgc
tggttcaccctgatcgaaccgcgggcgggggtcctggagcaggccgtccgccgccgcgtg
ctacgcggtaccggcctcggcgacgcgctgcgcgggcgcatgtcggggcagcacatctcg
ggtggcggacgatga

DBGET integrated database retrieval system