KEGG   Thioalkalivibrio nitratireducens: TVNIR_0163Help
Entry
TVNIR_0163        CDS       T02408                                 

Gene name
proB_[H]
Definition
Glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tni01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tni00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
159393..160511
Genome map
AA seq 372 aa AA seqDB search
MRNGFPRVRRVVIKIGSALITGDGTGLDRVALTGWAREIAELRQQGYEVVLVSSGAVAEG
MHRLGMRERPHALHLLQAAAAVGQMGLIQAYEREFAGHGLHAAQVLLTHDDLADRARYLN
ARSTIQALLGLGTIPVVNENDTVANDEIRLGDNDTLGALVANLLVADLLLILTDQHGLFD
RDPRAHADARLIDEGKASDPALHAYVSGTFGRLGRGGMATKLLAAERAARSGTHTVIAFG
RQPEVVARVARGENIGTWLKPDREPLAARKRWIADQLHSRGELRLDAGAARVLRESGRSL
LPVGVVGVRGAFRRGEVVTCVDPEGQPIARGLCNYGSDEVRRIRGLKADLVESVLGYVAE
PELIHRDNLVLL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaacggcttcccccgggtccgccgggtcgtgatcaagatcggcagcgcgctgatc
accggtgacggcaccgggctcgaccgggtggcgctgaccggctgggcgcgcgagatcgcc
gagctgcggcagcagggctacgaggtggtgctggtgtccagcggggcggtcgccgagggg
atgcaccgcctcggcatgcgcgaacgcccgcatgcgctgcacctgctgcaggcggccgca
gcggtcggccagatggggctgatccaggcctacgagcgggaatttgccggccacgggctg
cacgcggcgcaggtgctgctgacccatgacgacttggccgaccgcgcccgctacctgaac
gcccgcagcaccatccaggctctgctcgggcttggcacgatcccggtggtgaacgagaac
gacaccgtcgcaaacgacgagatccgcctgggcgacaacgataccctcggcgcgctggtc
gcgaacctgctggttgccgatctgctgctgatcctgaccgaccagcacggcctgttcgac
cgggatccccgcgcccacgcggatgcccggttgatcgacgaaggcaaggcctcggatcct
gcactgcacgcgtatgtatcgggcaccttcgggcggctggggcggggcggcatggccacc
aagctgctggcggccgaacgggcggcccgttcaggaacgcacacagtgatcgccttcgga
cgccaaccggaggtcgtcgcgcgagtggcgcgcggcgaaaatatcggtacctggctgaag
ccggaccgcgagccgctggccgcgcgcaagcgctggattgccgatcagttgcactcgcgc
ggcgaactgcggctggatgccggtgccgcgcgggtgctgcgcgaatcggggcgaagcctg
ctgccggtgggcgtggtcggtgtgcggggcgctttccgccgcggcgaggtggtgacctgc
gtcgaccccgagggccagccgatcgcgcgggggctttgcaactacgggtccgacgaggtc
cggcgcatccgcggcctcaaggccgatctggtcgagtcggtgctggggtatgtcgccgag
cccgaattgattcaccgcgacaacctggtgctgctgtag

DBGET integrated database retrieval system