KEGG   Thioalkalivibrio nitratireducens: TVNIR_0163Help
Entry
TVNIR_0163        CDS       T02408                                 

Gene name
proB_[H]
Definition
Glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TVNIR_0163 (proB_[H])
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TVNIR_0163 (proB_[H])
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    TVNIR_0163 (proB_[H])
Enzymes [BR:tni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TVNIR_0163 (proB_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
159393..160511
Genome map
AA seq 372 aa AA seqDB search
MRNGFPRVRRVVIKIGSALITGDGTGLDRVALTGWAREIAELRQQGYEVVLVSSGAVAEG
MHRLGMRERPHALHLLQAAAAVGQMGLIQAYEREFAGHGLHAAQVLLTHDDLADRARYLN
ARSTIQALLGLGTIPVVNENDTVANDEIRLGDNDTLGALVANLLVADLLLILTDQHGLFD
RDPRAHADARLIDEGKASDPALHAYVSGTFGRLGRGGMATKLLAAERAARSGTHTVIAFG
RQPEVVARVARGENIGTWLKPDREPLAARKRWIADQLHSRGELRLDAGAARVLRESGRSL
LPVGVVGVRGAFRRGEVVTCVDPEGQPIARGLCNYGSDEVRRIRGLKADLVESVLGYVAE
PELIHRDNLVLL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaacggcttcccccgggtccgccgggtcgtgatcaagatcggcagcgcgctgatc
accggtgacggcaccgggctcgaccgggtggcgctgaccggctgggcgcgcgagatcgcc
gagctgcggcagcagggctacgaggtggtgctggtgtccagcggggcggtcgccgagggg
atgcaccgcctcggcatgcgcgaacgcccgcatgcgctgcacctgctgcaggcggccgca
gcggtcggccagatggggctgatccaggcctacgagcgggaatttgccggccacgggctg
cacgcggcgcaggtgctgctgacccatgacgacttggccgaccgcgcccgctacctgaac
gcccgcagcaccatccaggctctgctcgggcttggcacgatcccggtggtgaacgagaac
gacaccgtcgcaaacgacgagatccgcctgggcgacaacgataccctcggcgcgctggtc
gcgaacctgctggttgccgatctgctgctgatcctgaccgaccagcacggcctgttcgac
cgggatccccgcgcccacgcggatgcccggttgatcgacgaaggcaaggcctcggatcct
gcactgcacgcgtatgtatcgggcaccttcgggcggctggggcggggcggcatggccacc
aagctgctggcggccgaacgggcggcccgttcaggaacgcacacagtgatcgccttcgga
cgccaaccggaggtcgtcgcgcgagtggcgcgcggcgaaaatatcggtacctggctgaag
ccggaccgcgagccgctggccgcgcgcaagcgctggattgccgatcagttgcactcgcgc
ggcgaactgcggctggatgccggtgccgcgcgggtgctgcgcgaatcggggcgaagcctg
ctgccggtgggcgtggtcggtgtgcggggcgctttccgccgcggcgaggtggtgacctgc
gtcgaccccgagggccagccgatcgcgcgggggctttgcaactacgggtccgacgaggtc
cggcgcatccgcggcctcaaggccgatctggtcgagtcggtgctggggtatgtcgccgag
cccgaattgattcaccgcgacaacctggtgctgctgtag

DBGET integrated database retrieval system