KEGG   Thioalkalivibrio nitratireducens: TVNIR_0360Help
Entry
TVNIR_0360        CDS       T02408                                 

Gene name
trpC_[H]
Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TVNIR_0360 (trpC_[H])
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TVNIR_0360 (trpC_[H])
Enzymes [BR:tni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TVNIR_0360 (trpC_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
350025..350861
Genome map
AA seq 278 aa AA seqDB search
MAGVMPGPAGVPDILQRILARKQEEIQARCAARPLPELEARARAADPPRGFRAALAARME
LGLPAVIAEIKKASPSKGVLRADFDPAAVAGSYARHGAACLSVLTDIDFFQGSDDYLRQA
RAACSLPVLRKDFVMDAYQVYEARALGADCILLIVAALDDAQMRSLYRLAQELGMDVLVE
VHDGAELGRALDLDAGLIGINNRDLRSFETRLETTLDLCAQVPEGVLLVTESGIHQPADV
ARMRAAGIEAFLVGEAFMLAPDPGEALQRLFGAGPDAA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgtgatgcccggcccggccggggtacccgacatcctgcagcggatcctcgcg
cgcaagcaggaagagatccaggcgcgttgtgcggcgcgtccgttgccggaactcgaggcc
cgggcccgggccgccgatccaccccgcggcttccgtgcggcgctcgcggcgcggatggaa
ctgggcctgcccgcggtcatcgccgagatcaagaaggccagtccgagcaagggcgtgctg
cgtgccgatttcgatcccgccgcggttgccggcagctatgcccggcacggcgcggcctgc
ctgtcggtgctgaccgatatcgatttctttcaggggtcagacgactacctgcgccaggcc
cgtgccgcctgcagcctgccggtactgcgcaaggacttcgtgatggatgcctatcaggtt
tacgaggcgcgtgcgttgggagccgactgcatcctgctgatcgtggccgcgctggacgat
gcgcagatgcgctcgctgtaccggctggcgcaggaactcggcatggacgtgctggtggag
gtccacgacggggccgaactcgggcgcgcactggacctggatgccgggctgatcgggatc
aacaaccgcgacctgcgcagcttcgagacccgcctggagacgacgctggatctctgcgcg
caggttccggagggcgtgctgctggtcacggagagcgggatccaccagcctgccgacgtc
gcccggatgcgggcggccgggatcgaagcgttcctggtgggggaagccttcatgctggcc
ccggacccgggcgaggcgctgcagcgcctgttcggggcagggccggatgcagcctga

DBGET integrated database retrieval system