KEGG   Thioalkalivibrio nitratireducens: TVNIR_0811Help
Entry
TVNIR_0811        CDS       T02408                                 

Gene name
recR_[H]
Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tni00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TVNIR_0811 (recR_[H])
DNA repair and recombination proteins [BR:tni03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TVNIR_0811 (recR_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
734066..734662
Genome map
AA seq 198 aa AA seqDB search
MTTEPALEELIAALRCLPGVGNKSARRMALHLLERDRAGARRLSRALEVAADTVGHCSRC
RTLTAADTCARCLDPSRDPGVICVVETPGDVLAIEAATDFRGVFHVLLGRLSPLDGIGPS
ELGLDRLEQRLHDEPVRELILATNASVEGEVTAHYLAEMAARHGVRATRIAQGVPAGGEL
EYLDAGTLAHALSGRREY
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgagcccgccctcgaggaactgatcgcggcactgcgctgcttgccgggtgtc
ggcaacaagtcggcgcggcggatggcgctgcatctgctggaacgcgatcgagcgggagct
cgccggctgtcccgagcgctggaggtggctgcggacacggtcggacactgttcccgctgt
cgcacgctgacggctgccgatacctgtgcgcgctgcctcgacccctcgcgcgacccgggt
gtgatctgtgtggtcgaaaccccgggcgacgtgctggccatcgaggcggctaccgatttc
cgcggggtgtttcatgtgctgctggggcgcctttcgccgctcgacggcatcggcccttcg
gaactggggctggaccggctggagcagcggctgcacgatgaacccgtgcgcgagctcatc
ctggccacgaatgcctcggtggaaggcgaggtgaccgcgcactacctcgccgagatggct
gcacgtcacggcgtgcgagccacgcggatcgcgcagggcgtgccggccgggggcgaactg
gagtacctggacgccggcacgctcgcccatgccttgtcgggccggcgcgaatattga

DBGET integrated database retrieval system