KEGG   Thioalkalivibrio nitratireducens: TVNIR_1035Help
Entry
TVNIR_1035        CDS       T02408                                 

Gene name
pcaF_[H]
Definition
(GenBank) 3-ketoacyl-CoA thiolase; Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TVNIR_1035 (pcaF_[H])
   00630 Glyoxylate and dicarboxylate metabolism
    TVNIR_1035 (pcaF_[H])
   00640 Propanoate metabolism
    TVNIR_1035 (pcaF_[H])
   00650 Butanoate metabolism
    TVNIR_1035 (pcaF_[H])
  Lipid metabolism
   00071 Fatty acid degradation
    TVNIR_1035 (pcaF_[H])
   00072 Synthesis and degradation of ketone bodies
    TVNIR_1035 (pcaF_[H])
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TVNIR_1035 (pcaF_[H])
   00310 Lysine degradation
    TVNIR_1035 (pcaF_[H])
   00380 Tryptophan metabolism
    TVNIR_1035 (pcaF_[H])
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TVNIR_1035 (pcaF_[H])
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TVNIR_1035 (pcaF_[H])
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TVNIR_1035 (pcaF_[H])
Enzymes [BR:tni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TVNIR_1035 (pcaF_[H])
Exosome [BR:tni04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TVNIR_1035 (pcaF_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
956912..958240
Genome map
AA seq 442 aa AA seqDB search
MTTLTTGSGARPVYLVDGLRTPYLKVRDAPGAFRASDLAVAAGRALLLRQPLRATDLDEV
VFGCVASGPDEANIGRVIALRLGCGHRVPGWTVQRNCASGLQALDSAAKDIALGRADLVL
AGGTEAMSHHPVLYRPEMVAWLGRFSRTRGVWGRLRELARLRPSHLKPVIGLLRGLTDPV
VGLSMGQTAEVLAARFGIGRAEMDAFAVESHRRLGAAVDSGRMAPELVTLYHQGRIVDRD
DGLRPDSSLENLAKLHPAFDRPHGSVTAGNSAQITDGAACMLLASADAVERHGLVARARV
VDVAWAGLDPAQMGLGPAYAIERLLSRTGLEIPAIDYWEINEAFAAQVLACLRALVDPDF
CRSELGRDKPMVPIDPERLNVDGGAISLGHPVGSSGARITWHLLRTLEARRAQRGVASLC
IGGGQGGAVLLERTDAGVPGES
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgacgacactcaccacggggtcaggcgcacgcccggtctacctggtcgatggtttgcgc
actccctacctcaaggtccgcgacgcgccgggagcgtttcgcgcctcggacctcgcggtg
gctgcaggacgggcgctgttgctgcgccagccgttgcgggcgaccgatctcgacgaagtc
gtattcggttgcgtggcctctgggccggacgaggccaatatcgggcgcgtcatcgcgctg
cgccttggctgcggccatcgtgtacccggatggacggtacagcgcaactgcgcctccgga
ctccaggcgctggactccgcagccaaggatattgcgctggggcgggccgatttggtgctc
gccgggggtaccgaggcgatgagccatcacccggtgctgtaccgtccggagatggtggcc
tggctcggccgcttcagccggacgcgtggcgtatggggccggttgcgggaactggcgagg
ctgcgccccagccacctgaagccggtgatcggcctgctgcgcgggctgacggacccggtc
gtgggtctcagcatgggccagacggccgaggttctggctgcccgcttcgggattggccgt
gccgagatggatgcgttcgcggtggagagtcaccggcgtcttggcgctgcggtcgattcc
ggccggatggctccggaactcgtgacgctctatcaccagggtcggatcgttgaccgggac
gacgggctgcggcccgattcctcgctggagaacctcgcgaaactgcatcccgcgttcgac
cggcctcacggcagcgtcaccgcgggaaactcggcccagatcaccgacggggcagcctgc
atgctgctggcctcggcggacgcggtcgaacgccacggactcgttgcccgggcccgggtc
gtggatgtcgcctgggccggcctggaccccgcccagatgggtctcggccccgcgtatgcg
atcgagcggctgctgtcgcgtacggggctggaaatcccggcgatcgattactgggaaatc
aacgaggcgtttgcggcgcaggtgctggcctgtctgcgggccttggtcgacccggacttc
tgccgaagcgaactcgggcgggacaaacccatggtcccgatcgaccccgagcgtctgaac
gtcgacggtggtgcgatcagcctgggacatcccgtgggcagcagcggcgcgcggatcacc
tggcatctgctgcgcacgctggaggcgcgccgcgcgcaacgcggcgtggccagcctctgc
atcgggggcgggcagggtggtgcggtgctgctcgaacgaacagacgcgggcgtaccggga
gaatcctga

DBGET integrated database retrieval system