KEGG   Thioalkalivibrio nitratireducens: TVNIR_1036Help
Entry
TVNIR_1036        CDS       T02408                                 

Gene name
fadJ_[H]
Definition
(GenBank) Enoyl-CoA hydratase / Delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase / 3-hydroxyacyl-CoA dehydrogenase / 3-hydroxybutyryl-CoA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
tni  Thioalkalivibrio nitratireducens
Pathway
tni00071  Fatty acid degradation
tni00280  Valine, leucine and isoleucine degradation
tni00281  Geraniol degradation
tni00310  Lysine degradation
tni00362  Benzoate degradation
tni00380  Tryptophan metabolism
tni00410  beta-Alanine metabolism
tni00640  Propanoate metabolism
tni00650  Butanoate metabolism
tni00903  Limonene and pinene degradation
tni00930  Caprolactam degradation
tni01040  Biosynthesis of unsaturated fatty acids
tni01100  Metabolic pathways
tni01110  Biosynthesis of secondary metabolites
tni01120  Microbial metabolism in diverse environments
tni01130  Biosynthesis of antibiotics
tni01200  Carbon metabolism
tni01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tni00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TVNIR_1036 (fadJ_[H])
   00650 Butanoate metabolism
    TVNIR_1036 (fadJ_[H])
  Lipid metabolism
   00071 Fatty acid degradation
    TVNIR_1036 (fadJ_[H])
   01040 Biosynthesis of unsaturated fatty acids
    TVNIR_1036 (fadJ_[H])
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TVNIR_1036 (fadJ_[H])
   00310 Lysine degradation
    TVNIR_1036 (fadJ_[H])
   00380 Tryptophan metabolism
    TVNIR_1036 (fadJ_[H])
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TVNIR_1036 (fadJ_[H])
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TVNIR_1036 (fadJ_[H])
   00281 Geraniol degradation
    TVNIR_1036 (fadJ_[H])
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TVNIR_1036 (fadJ_[H])
   00930 Caprolactam degradation
    TVNIR_1036 (fadJ_[H])
Enzymes [BR:tni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     TVNIR_1036 (fadJ_[H])
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TVNIR_1036 (fadJ_[H])
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     TVNIR_1036 (fadJ_[H])
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 AlaDh_PNT_C Pyr_redox_2 Pyr_redox DLH
Motif
Other DBs
NCBI-ProteinID: AGA32720
UniProt: L0DUQ0
Position
958240..960264
Genome map
AA seq 674 aa AA seqDB search
MKHWTLDRSDDGIAWLTFDQAGTPVNTLGTETLEELEQALTLCEREPLVGLLIRSAKAGG
FVAGADVKTFPELRDAGQARTLMRRAHEILQHLERLPFPSVAMVHGYCLGGGLELALACT
ARVATSEPETRIGFPEIRLGIFPGFGGTARAIERAGHLAAMDLMLSGRSVSGRAARKLGV
VDDCVPRRHLETAARRLLERPPRRRRATGWQQVAGWPGLRSLAAARMRRAAGRHADPAHY
PAPGALIDHWRRNAGKREALLRGEIETVPELLTGRVAQNLMRLFLLRERLRSAGDHPPPR
PGHLHVIGAGVMGGDIAAWAASHGLRVSLQDQAPEPLARALARGREFLERKLRDPLRVRE
AMDRLIPDVAGDGVRHAEVVLEAIVENVEAKQAVYRQALPQMKPGALLATNTSSITLETL
TAGMDAPGRLVGLHFFNPVAKMPLVEVIHGSETDPEAVRTAQSLARHLDKVPVPVRSNPG
FLVNRILMPYLLEAVALFEEGVRAETVDRAATAFGMPMGPLELADTAGLDICLSVAEKMS
GLLRTPVPESLRRRVAAGQLGRKSGEGYYHWPLTRPRGARAPGFTREQQDRLILRLLNEA
VACLREDVVASADELDAGVVFGTGFAPFRGGPLRHIRESGPRGLHERLLALRQRLGDRFS
PDPGWDALNTGGDP
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgaaacactggacactggaccgatcggacgacgggattgcctggctgaccttcgatcag
gcggggacgccggtcaataccctcgggaccgaaacgctcgaagagctggagcaggcgttg
acgctttgcgagcgggaaccgctcgtgggcctgttgatccgctcggccaaggccggcggc
ttcgtcgcaggcgctgacgtcaagacgtttccagagctgcgcgacgcggggcaggcccgg
accctgatgcgtcgtgcgcacgagatcctgcagcacctcgagcgtctaccgttcccgagc
gtggccatggtccacggctactgcctggggggcggcctcgagttggcgctggcctgcacc
gccagggtggcgacctcggaaccggagacccggatcggctttccggaaatccgcctcggc
atcttcccggggttcggcggcacggcgcgcgcgatcgagcgcgcgggccacctggccgcg
atggacctgatgctgagcggtcgcagcgtatccggccgggccgcccggaagctcggcgtc
gtggacgactgcgtgccgcggcgtcatctcgagaccgcggcacgtcggctgctcgaacgc
ccgccgcgccggcgcagggccaccggctggcagcaggtggccggctggcccggcctgcgc
tcgctcgcggccgcgcggatgcggcgtgccgcgggccgacacgcggacccggcgcactac
ccggcgcctggcgcgctgatcgatcactggcgccgaaacgccgggaaacgtgaggcgtta
ctccggggcgagatcgagacggtgccggagctgctgaccgggcgagtcgcgcagaatctc
atgcgcttgtttctgttgcgggaacggctcaggagtgccggcgatcacccgccgccacgg
cctggtcacctgcacgtgatcggcgccggggtcatgggcggcgacatcgccgcctgggcc
gcgtcgcacggcctccgggtcagtctccaggaccaggcgccggaaccgctggcgcgggcc
ctggcgcggggccgggagttcctggaacggaagctgcgcgacccgctgcgtgtgcgcgag
gcaatggaccgcctgatcccggacgtggcgggggacggcgtgcgccacgccgaggtcgtc
ctcgaggcgattgtcgagaacgtcgaagcgaaacaggcggtctatcggcaggcgctcccg
cagatgaagccaggggccctcctcgcgaccaatacatcgagcatcacgctggaaaccctg
accgccgggatggacgcaccggggcgactggtcggcctgcatttcttcaacccagtggca
aagatgccgctggtggaggtcatccacggtagcgaaaccgaccccgaagcggtgcgcacg
gcccagtcgctggcccgccacctcgacaaggtgccggtgcccgtgcgcagcaacccgggc
ttcctggtcaaccgcatcctgatgccatatttgctggaggccgtggcactgttcgaagag
ggggtgcgtgccgagacggttgaccgtgcggcgaccgcattcggcatgccgatgggcccg
ctggaactcgcggacaccgcgggcctcgatatctgcctgtcggtggccgagaagatgtcc
gggctcctgaggacgccggtgcccgagtcgttgcggcggcgggtcgcggccggtcagctg
gggcgcaagagcggcgagggctactatcactggccgttgacgcgcccgcgtggagcgagg
gcacccggcttcacgcgggaacagcaggatcgtctgattctgcgcctgctgaacgaggcg
gtggcctgcctgcgcgaggacgtggtggcctcggcggacgagctcgacgcgggtgtggtg
ttcggtaccggcttcgcgcccttccggggcggaccgctgcgccatatccgggagagcggg
ccacgcgggctgcacgagcgcctgctggcgctgcgccagcgtctcggcgaccgcttcagc
ccggacccgggatgggacgccctgaacaccggaggggacccatga

DBGET integrated database retrieval system